SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015509 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015509
Domain Number 1 Region: 56-276
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.44e-49
Family G proteins 0.0011
Further Details:      
 
Domain Number 2 Region: 279-344
Classification Level Classification E-value
Superfamily TGS-like 9.81e-16
Family G domain-linked domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015509   Gene: ENSDORG00000016484   Transcript: ENSDORT00000016484
Sequence length 345
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5576:226125:241869:1 gene:ENSDORG00000016484 transcript:ENSDORT00000016484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGILEKISEIEKEIARTQKNKLGLLKKLYRAQLLEPSKSSSKGEGFDVMKSGDARVLIGF
PSVGKSTFLSLMTSTTSEAASYEFTTLTCIPGVIEYKGANIQLLDLPGIIEGAAQGKGRG
RQVIAVARTADVVIMMLDATKGEVQRSLLEKELESVGIRLNKHKPNIYFKPKKGGGISFN
STVTLTQCSEKLVQLILHEYKIFNAEVLFREDCSPDEFIDVIVGNRVYMPCLYVYNKIDQ
ISMEEVDRLARKPNSVVISCGMKLLDYLLEMLWEYLALTCRPDFTDAIILRKGASVEHVC
HRIHRSLASQFKYALVWGTSTKYSPQRVGLTHTMEHEDVIQIVKK
Download sequence
Identical sequences ENSDORP00000015509 ENSDORP00000015509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]