SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015549 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015549
Domain Number 1 Region: 289-479
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-39
Family SPRY domain 0.0001
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily RING/U-box 1.41e-26
Family RING finger domain, C3HC4 0.0047
Further Details:      
 
Domain Number 3 Region: 88-147
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000229
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015549   Gene: ENSDORG00000016526   Transcript: ENSDORT00000016526
Sequence length 481
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2749:11837:23187:-1 gene:ENSDORG00000016526 transcript:ENSDORT00000016526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAVLTNIKEEVTCPICLELMIEPMSIDCGHSFCQACITSNYHRPRGETNCPVCRIPYT
VENLRPNRHVANIVHSLKEARLILEEENVHHCAEHGVKLQLFCKDDGKVICWLCERSLQH
RGHHTYLLEEVAQEYQNKLLVAVKKMKKKKEESEKWKAELQEEKILWKKHIQVKRENVWA
KFEKLRGILASEEAKELQRLKEDDENVLNSLEKSENELAQRNELVTELISELEHRLHGSR
MEMLQXXXXXXXXCDILTMEKPITFPKEERRLYQAPDLTGMLQEFQELTDAHRYWVHVTI
NENNHREMVISKDQRQIRYKEHIIFQTHEVSMVNYSPGALGLPLITSGKHYWEVDLSKKA
SWLLGLSDGFSSVAKFNIEKEKHYQRKNGYWIIGMENKYEYMAFEPSPTTYNSLTSKFFP
PTPLKRVGVFLDYEAGTVSFYNVTYHGLLIYKFTKCCFTTEVFPYFNPLQCSEPMMLCSN
S
Download sequence
Identical sequences ENSDORP00000015549 ENSDORP00000015549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]