SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015559 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015559
Domain Number 1 Region: 61-156
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.37e-25
Family Ankyrin repeat 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015559   Gene: ENSDORG00000016536   Transcript: ENSDORT00000016536
Sequence length 270
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5312:115437:119304:1 gene:ENSDORG00000016536 transcript:ENSDORT00000016536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKREALAASQEPPPEPEEITGPVDEE
TFLKAAVEGKMKLIEKFLADGGSADTCDEFRRTALHRASLEGHMEILEKLLESGATVDFQ
DRLDCTAMHWACRGGHLEVVKLLQSRGADTNVRDKXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXMLLLHGADMMTKNLAGKTPTDLVQLWQSDTRH
ALEHPEPESEQNGFEGPASGRETPQPVPAQ
Download sequence
Identical sequences ENSDORP00000015559 ENSDORP00000015559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]