SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015587 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015587
Domain Number 1 Region: 1415-1678
Classification Level Classification E-value
Superfamily BEACH domain 2.75e-97
Family BEACH domain 0.0000000752
Further Details:      
 
Domain Number 2 Region: 1335-1378
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000676
Family PreBEACH PH-like domain 0.022
Further Details:      
 
Domain Number 3 Region: 138-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000844
Family Laminin G-like module 0.048
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015587
Domain Number - Region: 1967-2092
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00101
Family WD40-repeat 0.019
Further Details:      
 
Domain Number - Region: 24-84,433-455,483-631
Classification Level Classification E-value
Superfamily ARM repeat 0.00483
Family Armadillo repeat 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015587   Gene: ENSDORG00000016568   Transcript: ENSDORT00000016568
Sequence length 2123
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4449:37664:60223:1 gene:ENSDORG00000016568 transcript:ENSDORT00000016568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCPPPPIRNEQPVLVLMQWLPALPTAELQLFLAQRLQWLCTSCPASRATCVQAGLVGYLL
EALSLGIGLGARCQEQLLALLQALGRVSLRPMELRRLLRPPPGLVSGSEAQKAQHAASII
RALSGMARHQGPTRSLRYFDLTPSMAGIMVPPIQRWPGPAFTFHAWLCLHSANTAPASVS
PQPFQRKQLYSFFTSSGSGFEAFFTAAGALVVAVCTRKEYLTVSLPEVSFADSAWHSVGI
VHVPGRRPFSQNLVHVYKDGHLVKLAXPPTPTLPFSSCCIGSAGHRTTTTTTGPPSPPVP
AALAPTHPSLTRSQSVPASTGLGWGSGSVASLPEGSISSTLAGTQDTRWGSPTSLEGELG
SVAIFHEALQATTLRNLYALGPNEPAPFKPEGELHELGAKLLLHYSPQACKNNICLDLSP
SQGLDGRLTGHRVETWDVKDVINCVGGMGALLPLLEKVAAQPHQADAAPAETHDLVGPEL
TSNHNAQGLLLPLGKSSEERMERNAVAAFLLMLRNFLQDHAVNQESLVQCQGPAIIGALL
RKVPNGAMDMNVLMSAQLLMEQVAAESAGPLLYLLYQHLLFNFHLWALSDFAVRLGHIQY
MSSIIREHRQKLRKKYGVQFILDALRTHYSPQRERPLAADDLRTVQTSLLGLAREFLVRS
FSADDVQVVLSFLAAVGDDSLILRRLQQNERLPERSRQRLRLRDGGLQGLVACLPEGTVS
PQLCQGLYKLFLGAGSGNNASSSGGGGGSSNGTITPASQPGTPSPLDGARPFPTAHGRHS
SSLSNVLEDGSFLEPTVSGDDTSNTSNPQQTPEEELCNLLTNVLFSVTWRGVEGSDEAAW
RERGQVFSVLTQLGASATLVRPPDCIKRSLLEMMLESALTDIKEAPPGGLGALTQQALWL
LRLLQDFLCAEGHGNQELWSEKLFEGVCSLLDRLGAWPHLTNSTADLRELAQIGLRLVLG
YILLEDPQLHAQAYVKLHTLLQTAAPVRRQEACYVLSKLEAALSRALNAAPSSPDTLTEN
ARAPPAKATTASERCSWLVPLVRTLLDRAYEPLGLQWGLPSLPPTNGSPTFFEDFQAFCA
TPEWRHFIDKQVQPTMSQFEMDTYAKSHDLMSGFWNACYDTLMSSAQRHQQERLQCRRAF
QELGLTPWQELVCLEGLRYATSLKQQAAQHSTALLHWGALWRQLSSPCGAWALXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIGHDFRRPLAQLREVHLRRFNLRRSALELFFIDQSNYFLNFPCKA
PAAAGSGSGSPPYPSPPHTHIRNQVYSWLLRLRPPSQGYLSSRSPQEMLRASGLTQKWVQ
REISNFEYLMQLNTIAGRTYNDLSQYPVXXXXXXXXXXXXXDLSNPSVFRDQSNPIGVVN
PKHAQLVREKYESFEDPAGTIDKFHYGTHYSNAAGVMHYLIRVEPFTSLHVQLQSGRFDC
SDRQFHSVAAAWQARLESPADVKELIPEFFYFPDFLENQNGFDLGCLQLTNEKVGDVVLP
PWASSPEDFIQQHRRALESEYVSAHLHEWIDLIFGYKQRGPAAEEALNVFYYCTYEXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQFVAALQPPGALPGPVSHLALGSEG
QIVVQSSAWERPGAQVAYTLHLYSVNGRLRASLPLTEQPTALTVMEDFVLLGTAQCALHI
LHLNKLNPAAPPLPMKVPVRSLAVTKESSHVLVGLEDGKLIVVGAGQPSEVRSSQFARKL
WRSSRRISQVSSGETEYNPGEAR
Download sequence
Identical sequences ENSDORP00000015587 ENSDORP00000015587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]