SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015590 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015590
Domain Number 1 Region: 44-206
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.31e-36
Family Dual specificity phosphatase-like 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015590   Gene: ENSDORG00000016571   Transcript: ENSDORT00000016571
Sequence length 211
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2850:9884:18206:-1 gene:ENSDORG00000016571 transcript:ENSDORT00000016571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCPGNWLWASMTFMARFSRSSSRSPVRTRGSLEEMPTVQHPFLNVFELERLLYTGKTACN
HADEVWPGLYLGDXXXXXXXXXXXXXXXXXXXXXXXXXWRGTPEAYEGLGIRYLGVEAHD
SPAFDMSIHFQAAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHFTLVEAIK
KVKDHRGIIPNRGFLRQLLALDRRLRQGLEA
Download sequence
Identical sequences ENSDORP00000015590 ENSDORP00000015590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]