SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015635 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015635
Domain Number 1 Region: 27-196
Classification Level Classification E-value
Superfamily vWA-like 2.92e-45
Family Integrin A (or I) domain 0.00067
Further Details:      
 
Domain Number 2 Region: 507-691
Classification Level Classification E-value
Superfamily vWA-like 8.07e-43
Family Integrin A (or I) domain 0.0011
Further Details:      
 
Domain Number 3 Region: 280-501
Classification Level Classification E-value
Superfamily vWA-like 4.08e-36
Family Integrin A (or I) domain 0.0082
Further Details:      
 
Domain Number 4 Region: 696-736
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000238
Family EGF-type module 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015635   Gene: ENSDORG00000016619   Transcript: ENSDORT00000016620
Sequence length 738
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4900:728:23386:1 gene:ENSDORG00000016619 transcript:ENSDORT00000016620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPSLPFQEVHVSRETIGKIAVASKMMWCSAALDVLFLLDGSQSIGKGSFERAKHFAITVC
DTLDISPKRVRVGAFQFGSTPHLEFPLDSFSTRKEVKTELKRMVFKGGRTETGLALKHLL
HRGFPGGRNGSVPQLLILVTDGKSQGHVALPAKQLKEKGVTVFAVGVLFPRWEELHMLAS
EPWEQHVLLAEQVEDATNGLLSTLSSSGLCIPAAPDCRVEAHPCERKTLETIRELTGDAL
CWRGLRRADVVLALRCPFYSWKKVFVSHPASCYRTTCPGPCDSQPCQNGGTCIPEELGRY
HCLCPLAFGGEANCAPKLSVECRIDVLFLLDSSADTTLEGFLRAKAFVKHFVQNVLSEDS
RARVGVAVYNRELVVVVPVGEYQDVPDLVRSLDRIPFTSGPTLTGNALQQAAERGFGIAA
RTGQNRPRRVVVLFTESHSQDEVAGPALHARARELLLLAIGRVAVRAELEEITGNPEHVM
VYTDPQDLFAQIPELQRKLCSRPQTGCQAQSLDLVFLLDSSASVGPENFAQMQGFVRSCA
LQFDVNPDVTQVGLVVYGSQVQTAFGLDTHLTRAATLRAMSQAPYLGGAGSAGMALLHIY
DKVMTVQRGARPGVPKAVVMLTGGKGAEDAAVPAQKLRNNGISVLVVGVGPVLREALRRL
AGPRDSLIHVATYADLHYHRDMLIEWLCREAKRPGSLCKPNPCMNEGTCVLRNGSYRCQC
RGGLEGPHCENRVLRCPT
Download sequence
Identical sequences ENSDORP00000015635 ENSDORP00000015635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]