SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015649 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015649
Domain Number 1 Region: 24-194
Classification Level Classification E-value
Superfamily MIR domain 1.96e-58
Family MIR domain 0.00000169
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015649   Gene: ENSDORG00000016634   Transcript: ENSDORT00000016634
Sequence length 211
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5052:42856:48037:-1 gene:ENSDORG00000016634 transcript:ENSDORT00000016634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVVPLLLLGGLWSAVGASSLAVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGV
TSVDDSNSYWRIRGKTASVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSA
FGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMA
QPSQNNYWKVMEGIFMKPSELLKAEAHHAEL
Download sequence
Identical sequences ENSDORP00000015649 ENSDORP00000015649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]