SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015659 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015659
Domain Number 1 Region: 170-239
Classification Level Classification E-value
Superfamily Homeodomain-like 6.42e-18
Family Homeodomain 0.0000519
Further Details:      
 
Domain Number 2 Region: 44-110
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000368
Family LIM domain 0.027
Further Details:      
 
Domain Number 3 Region: 14-42
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000112
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015659
Domain Number - Region: 107-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00104
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015659   Gene: ENSDORG00000016645   Transcript: ENSDORT00000016645
Sequence length 348
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4670:51414:61439:-1 gene:ENSDORG00000016645 transcript:ENSDORT00000016645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFV
RDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEF
ALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEK
TTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRS
IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ
SDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIA
Download sequence
Identical sequences ENSDORP00000015659 ENSDORP00000015659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]