SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015664 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015664
Domain Number 1 Region: 1020-1212
Classification Level Classification E-value
Superfamily vWA-like 1.91e-58
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 200-339
Classification Level Classification E-value
Superfamily vWA-like 3.02e-39
Family Integrin A (or I) domain 0.00049
Further Details:      
 
Domain Number 3 Region: 829-918
Classification Level Classification E-value
Superfamily Fibronectin type III 6.28e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 354-441
Classification Level Classification E-value
Superfamily Fibronectin type III 6.74e-18
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 5 Region: 740-827
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000604
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 6 Region: 1228-1320
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000633
Family Xylanase/endoglucanase 11/12 0.053
Further Details:      
 
Domain Number 7 Region: 923-1006
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000106
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 8 Region: 631-713
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000213
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 9 Region: 491-533
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000119
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 10 Region: 31-70
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000246
Family Fibronectin type III 0.0052
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000015664
Domain Number - Region: 1358-1432
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000142
Family Pentraxin (pentaxin) 0.069
Further Details:      
 
Domain Number - Region: 585-622
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00094
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015664   Gene: ENSDORG00000016651   Transcript: ENSDORT00000016651
Sequence length 1766
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6211:43362:202057:1 gene:ENSDORG00000016651 transcript:ENSDORT00000016651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIFQCKMRYWLIPAFVAIAYFCTIVQGQVAPPTRLRYNMLSHDSIQISWKAPRGKFGGY
KLLVTPTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDL
EKRKDSTKPRVKVVDRGNGSKPSSPEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXLAQYSGDPRIEWHLNAFSTKEEVIDAVRNLPYKGGNTLTGL
ALSYIFENSFKPEAGSRSGVSKIGILITDGKSQDDIIPPSRNLRESGVELFAIGVKNADL
NELQEIASEPDSTHVYNVAEFDLMHTVVESLTRTVCSRVEEQDKEIKASAIVPIGPPTEL
ITSEVTARSFMVNWTHAPGRVEKYRVVYYPTRGGKPEEVVVDGSVSSTILKNLMSSTEYQ
IAVFAIYAHTASEGLRGTETTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXMKIGETHTDIELTGLFPNTEYTVTVYAMFGEEASDPVTGQETTXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVEVDPITTFPLKGLTPLTEY
SVAIFSLYEEGQSLPLAGVFTTEEVPAQQYLEIDEVKTDGFRVTWHPLSAEEGPHKLMWI
PVYGGKTQEVALIEEQDSYVIEGLEPGTEYEVSLLAVLDDGSESEVVTAVGTTXXXXXXX
XXXXXXXXXXXXXXLQTGIRNLVVDGETTSSLRVTWDISDSNVEQFRVTYVTAQGGPMEE
VVGTVMVPGSQNSILLKALLPDMEYKVTVTPLYTDREGVSVSAPGKTLPSSGPQNLRVSE
EWYNRLRITWDPPAGPVKGYRIVYKPVSVPGPTLETFVGADVNTILITNLLSGMDYNVKI
FASQAEGFSDALSGLVKTLYLGVTDLQAHQIEMTSLCVGWQVQRHATAYRIVLESLQDTQ
TQESTVGGGTNRHCFYGLQPDSEYKISIYTKLQELEGPSVSIMERTXXXXXXXXXXXXXX
XXXXXXCKAAKADLVFMVDGSWSIGDDNFNKIINFLYSTVGALDRIGADGTQVAMVQFSD
DPRTEFKLNAYKTKETLLDAIRHISYKGGNTKTGKAIKHVRDTLFTAEAGTRRGIPKVIV
VITDGRSQDDVIKISREMQSDGYNIFAIGVADADYSELVNIGSKPSGRHVFFVDDFDAFK
KIEDELITFVCETASATCPVHDGMDLAFKMMEMFGLVEKDFSSVEGVSMEPGTFNLYPCY
HLHKDALVSQPTKYLHPEGLPSDYTISFLFRILPDTPQEPFALWEILNKNSDPLVGIILD
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHVVVSKTLAKVVVDCKQVGEKA
INASANVTADGVEVLGRMVRSRGPSGNSAPFQLQMFDIVCSTSWANRDKCCELPSLRDEE
SCPDLPHSCSCSAANEVVLGPAGPPGGPGLRGPKGQQGEQGPKGPEGPRGETGPVGPQGP
PGPQGPSGLSIQGMPGMPGEKGEKGDTGLPGSQGVPGGVGSPGRDGSPGQRXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVPGAKGERGERXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEPSRPGSPGTGEQGPPGAPGFGNAG
VPGTPGERGLTGFKGEKGNPGIGTQGPRGPPGPTGPSGESRPGSPGPPGSPGPRGPPGHL
GVPGPQGPSGQPGYCDPSSCSSYGVG
Download sequence
Identical sequences ENSDORP00000015664 ENSDORP00000015664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]