SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015682 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015682
Domain Number 1 Region: 97-707
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.27e-217
Family Neutral endopeptidase (neprilysin) 0.00000000063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015682   Gene: ENSDORG00000016671   Transcript: ENSDORT00000016671
Sequence length 707
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4329:10443:58950:1 gene:ENSDORG00000016671 transcript:ENSDORT00000016671 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARNGTAPPAPGPLPGLRMSTYKRATLDEEDLVDSLSEGDVYPNGLQVNFRSPRSGQRCWA
ARTPVERRLVVLVALLAAGLVACLAALGIQYRTRTPPVCLSEACVSVTSSILSSMDPSVD
PCQDFFSYACGGWIKANPVPDGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQV
YYHACMNETRIEELRAKPLMELIEKLGGWNITGPWAKDNFQDTLQVVTAHYRTSPFFSVY
VSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTGYLNYMVQLGKLLGGGDEDAI
RPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAQLQSLAPAINWLPFLNAIFYPVE
INESEPIVVYDKEYLEQVSTLINNTDKCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV
MYGTKKTCSRCVSDTDSLSFALGPMFVKATFAEDSKNVASEIILEIKKAFEESLSTLKWM
DEETRKSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVT
ADQLRKAPNRDQWSMTPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVV
GHELTHAFDDQGREYDKDGNLRPWWKNSSVEAFKQQTECMVGQYSNYSVNGEPVNGRHTL
GENIADNGGLKAAYRAYQNWVKKNGAEQTLPTLGLTNNQLFFLGFAQ
Download sequence
Identical sequences ENSDORP00000015682 ENSDORP00000015682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]