SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015700 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015700
Domain Number 1 Region: 11-160
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.92e-53
Family APC10-like 0.0000000797
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015700   Gene: ENSDORG00000016690   Transcript: ENSDORT00000016690
Sequence length 185
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4740:2056:18689:-1 gene:ENSDORG00000016690 transcript:ENSDORT00000016690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNLKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
Download sequence
Identical sequences A0A1S3G818
ENSDORP00000015700 ENSDORP00000015700 XP_012884968.1.60039 XP_012884969.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]