SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015728 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015728
Domain Number 1 Region: 63-306,413-468
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.55e-34
Family FAD-linked reductases, N-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015728   Gene: ENSDORG00000016720   Transcript: ENSDORT00000016720
Sequence length 469
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4871:59920:65614:1 gene:ENSDORG00000016720 transcript:ENSDORT00000016720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRRALQRGLRPGLSFRRLGTRRGGSTLDWDGKVAEIRKKIQSALPGDTWDPLYDTSHLP
PEHADVVVVGGGVIGLSVAYWLKKLEKKRDAIRVLVVERDSTYSKASTVLSVGGIRQQFS
LPENIQLSLFSANFLRNINEYLGVVDAPPVDLQFNPSGYLLLASDKDAAVLENNVKVQRQ
EGAKVCLMSPEHLRTKFPWINTEGVALASYGMEGEGWDPWSLLQARLKLQSMGVLFSQGE
VTRFVTSSTSMETSSGEQVNLKRIYEVHVKMDNSLEYQPVECAIVINAAGAWSGQVAELA
GIGMGPPGTLQGIKLPVEPRKRYVYVWHCPQGPGLETPLVADVSRVYFRREGLGCNYLGG
RSPTEEEEPDPTNLEVDHDFFQDKVWPHLATRVPAFNNLKVQSAWAGFYDYTFDQNGVVG
PHPLVVNMYFATGFSGHGLQHASCGRAAEMVLEALQTIDMSPFLFSRFY
Download sequence
Identical sequences ENSDORP00000015728 ENSDORP00000015728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]