SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000015742 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000015742
Domain Number 1 Region: 7-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000323
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 2 Region: 38-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000293
Family EGF-type module 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000015742   Gene: ENSDORG00000016736   Transcript: ENSDORT00000016736
Sequence length 196
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3838:40272:43033:1 gene:ENSDORG00000016736 transcript:ENSDORT00000016736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDECRVRSLCQHACRNTEGSYRCLCPSGYRLLPSGKTCQDINECEEERVECGPGQMCFNT
RGSFQCVDTPCPATYRQGPSPGTCFRRCSQDCSAQGASTLQYRLLPLPLGVRARHDVARL
AAFSEAGVPANRTELRVLQPDPRSPFALRPLRPGQGAVYTRRALTRPGLHRLTVRAAAPR
RQSLFVLLIAVSPYPY
Download sequence
Identical sequences ENSDORP00000015742 ENSDORP00000015742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]