SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000178 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000178
Domain Number 1 Region: 387-645
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-64
Family Nuclear receptor ligand-binding domain 0.000000000978
Further Details:      
 
Domain Number 2 Region: 315-392
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.04e-27
Family Nuclear receptor 0.0000098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000178   Gene: ENSDORG00000000196   Transcript: ENSDORT00000000196
Sequence length 647
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_2322:37986:60193:-1 gene:ENSDORG00000000196 transcript:ENSDORT00000000196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVQDKIKVADDSHGGWRPAPAPPWYPGSFCWVLKSEAVVMLIKACWFISEMPCIQAQYG
TPAPSPGPRDHLASDSLTPELSKPAMDLASPEAAPTAPTALPSFSTFMDGYTGEFDTFLY
QLPGTAQPCSSTSSASSTSSSSATSPASASFKLEDFQVYGCYPGTLSGPLDETLSSSGSD
YYGSPCSAPSPSTPSFQPPQLSPWDGSFGHFSPNQTYEGLRAWTEQLPKAAGPPQPAFFS
FSPPTGPSPSLAQSSLKLFPSQASHQLGEGESYSMPATFSGLAPTSPHLDSSGLLDAPMT
SAKARSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKYICLANKDCPV
DKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQTLDTSPVNLLTSLVRA
HLDSGPSTAKLDYSKFQELVLPRFGKEDAGDVQQFYDLLSSSLDVIRKWAEKIPGFTELS
PGDQDLLLESAFLELFILRLAYRSKPGEGKLIFCSGLVLHRLQCARGFGDWIDSILAFSR
SLHSLVVDVPAFSCLSALVLITDRHGLQEPRRVEELQNRIASCLKEHMAAVAGEPQPASC
LSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMDTLPF
Download sequence
Identical sequences ENSDORP00000000178 ENSDORP00000000178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]