SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000320 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000320
Domain Number 1 Region: 257-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 200-257
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-16
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 162-214
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000144
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000320   Gene: ENSDORG00000000342   Transcript: ENSDORT00000000342
Sequence length 330
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_25815:13274:17657:-1 gene:ENSDORG00000000342 transcript:ENSDORT00000000342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSFLVKSKKAHTYHQPRTPEDDPVWPAAVAPVARDQAPSGGPALSTLLPRQHLDWSIV
KLESELKLDQGLTKMASAPEKPTAASQPQDGNSPHAESPPFYKPSFSWDTLASTYGHSYQ
QTPSTMQSAFLEHSVHLYGSPLVPSTEPPLDFSLRFSPGMDAYHCVKCNKVFSTPHGLEV
HARRSHSGTRPFACDVCGKTFGHAVSLEQHAHVHSQERSFQCRMCGKAFKRSSTLSTHLL
IHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTG
FKPFSCELCAKGFQRKVDLRRHRESQHSLK
Download sequence
Identical sequences ENSDORP00000000320 ENSDORP00000000320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]