SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000565 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000565
Domain Number 1 Region: 155-207
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.0000000000363
Family Brix domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000000565
Domain Number - Region: 294-323
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 0.00167
Family Brix domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000565   Gene: ENSDORG00000000607   Transcript: ENSDORT00000000607
Sequence length 337
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3179:109104:120485:1 gene:ENSDORG00000000607 transcript:ENSDORT00000000607 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKAGGTSGGGGKKSLKRKAAAQEPQEATVVAGDAATENGVPPPKAAAFPPGFSISEIKN
KQRRHLMFTRWKQQQRKXXXXXXXXXXXXXXXXXXXAPPKPVPKTIDNQRVYDETTVDPN
DEEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRTVRLCEQLSTVIPDSHVYYRRGLA
LKKIIPQCISRDFTDLIVINEDRKVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYIFKS
EKKVGIQELGPRFTLKLRSLQKGTFDSKYGEYEWVHK
Download sequence
Identical sequences ENSDORP00000000565 ENSDORP00000000565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]