SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000000902 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000000902
Domain Number 1 Region: 9-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.32e-28
Family Laminin G-like module 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000000902   Gene: ENSDORG00000000960   Transcript: ENSDORT00000000961
Sequence length 642
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5590:4910:20750:-1 gene:ENSDORG00000000960 transcript:ENSDORT00000000961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGPLDILAEAVPAVSAVVGVRLVQTPGAQGLRLAAADPRALSFPASRIFYRCQRFPEEFS
IVVTLKAPSLPPKKNEYLLSVVAEERDALLLGLRFSSTQLHFLFLSEDAAGAWQTRVSFR
SPGLADSRWHTLVLAVSQGSFSLTTDCGLPVDVVADVSFPDTLSVQGAQFFIGSRRRTKG
LFTGLMRQLVLLPGSDATPSLCPSSNAHLAQLSIPPALQGFPGEPDDNEVLKYPYDANVR
VTLGTQPPCSRAQEAQFWFDAVRRGLYLCTRGQWLSVLAXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXD
NHNIDSVIYKWSPTTQLFEANQSIATSGAYDWEFFTVGPYSFLVVANTFNGTSTRLHSHL
YIWLVGAFRLFQSFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWQGYEGFV
PVHSLPTVGCRDWEAFHTATGSFLIYSSAKEPLSRVLQLRTI
Download sequence
Identical sequences ENSDORP00000000902 ENSDORP00000000902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]