SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001145 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001145
Domain Number 1 Region: 259-485
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-63
Family Nuclear receptor ligand-binding domain 0.00000000136
Further Details:      
 
Domain Number 2 Region: 135-210
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.32e-27
Family Nuclear receptor 0.0000664
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001145   Gene: ENSDORG00000001224   Transcript: ENSDORT00000001223
Sequence length 486
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_116:19232:65418:1 gene:ENSDORG00000001224 transcript:ENSDORT00000001223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMQFQGLENPIQISPHHSHISAGFVTEMMSMKPAKGVLTEQVAGSLGQNLDVEPYSQYS
NVPFPQVQPQISSSSYYPNLGFYPQQPEEWYSPGIYELRRMPAESLYQGETEMTEMPVTK
KPRMGTSAGRIKGDELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCV
MDMYMRRKCQECRLRKCKEMGMLAECMYTGLLTEIQCKSKRLRKNVKQHADQTAHEDSEG
RDLRQVTSTTKSFREKTELSPDQQNLLHYIMDSYRKQRMPQEITNKILKEEFSAEENFLI
LTEMATSHVQILVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPAGHAD
LLEERIRNSGISDEYITPMFSFYKSVGELKMTQEEYALLTAIVILSPDRQYIKDREAVEK
LQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLC
EIWDVQ
Download sequence
Identical sequences A0A1S3FEP5
ENSDORP00000001145 XP_012874755.1.60039 ENSDORP00000001145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]