SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001247 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001247
Domain Number 1 Region: 293-412
Classification Level Classification E-value
Superfamily POZ domain 3.34e-28
Family BTB/POZ domain 0.00047
Further Details:      
 
Domain Number 2 Region: 660-714
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000076
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001247   Gene: ENSDORG00000001337   Transcript: ENSDORT00000001336
Sequence length 797
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6646:4810:48369:1 gene:ENSDORG00000001337 transcript:ENSDORT00000001336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YALLRPNGRGADEEMELEGLEPHDSEASAGVAAAAAAEEAKELLLPQDASGPTSLGGGGV
GGPLLAERNRRTLAFRGGGGGGGLGNNGSSRGRPETSAWPLRHFNGRGPAAVDLELDALE
GKELMPDGASLSDSTEDEEEGASLGDGSGAEGGSCGSSRRSGGDGGDEAESSAVGAGEGE
TVQHLPLARPKSLMQKLQCSFQTSWLKDFPWLRYSKETGLMFCGWCQKTPEDGRTVDLPQ
VGHDELSRGTRNYKKTLLLRHHVSTEHKLHEANAQESEIPSEEGYCDFNSRPNENSYCYQ
LLRQLDEQRKKDILCDVSIVVSGKIFKAHKNILVAGSRFFKTLYCVSNKESPNQNNTTHL
DIAAVQGFSVILDFLYSGNLVLTSQNAIEVMTVASYLQMSEVVQTCRNFIKDALNISIKS
EAPESVVVDYNNRKPVNRDGLSSSRDQKIASFWATRNLTNLASNIKIENDGCNVDEGQIE
NYQMNDGNWVQDGSPELAENESQGQTKVFIWNNMGSXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDGALLSGPDGDRNMNANLLAETCSSQD
GGDAGTSHDFKYGLIPGPSSDFKYGLLPESWPKQETWENGESSLIMNKLKCPHCNYVAKY
RRTLKRHLLIHTGVRSFSCDICGKLFTRREHVKRHSLVHKKDKKYKCMVCKKIFMLAASV
GIRHGSRRYGVCVDCADKSQPGGQEGVDQGQDTEFSRDEEYEENEVGEADEELVDDGEDQ
NDPSRWDESDVCMSLDD
Download sequence
Identical sequences ENSDORP00000001247 ENSDORP00000001247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]