SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001376 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001376
Domain Number 1 Region: 483-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-48
Family SPRY domain 0.00063
Further Details:      
 
Domain Number 2 Region: 165-230
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.56e-17
Family B-box zinc-binding domain 0.0000332
Further Details:      
 
Domain Number 3 Region: 2-88
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000111
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001376
Domain Number - Region: 109-161
Classification Level Classification E-value
Superfamily RING/U-box 0.000777
Family ZZ domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001376   Gene: ENSDORG00000001477   Transcript: ENSDORT00000001473
Sequence length 667
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1220:141567:227041:-1 gene:ENSDORG00000001477 transcript:ENSDORT00000001473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METLESELTCPICLELFEDPLLLPCAHSLCFNCAHRILVSHCATNEPVESISAFQCPTCR
HVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERPFDANTMSSAEKVLCQ
FCDQDPAQDAVKTCVTCEVSYCDECLKATHPNKKPFTGHRLIEPIPDSHIRGLMCLEHED
EKVNMYCVADDQLICALCKLVGRHRDHQVAALSERYDKLKQNLESNLTNLIKRNTELETL
LAKLIQTCQHVEVNAARQEAKLTEECDLLIEIIQQRRQIIGTKIKEGKVMRLRKLAQQIA
NCKQCIERSASLISQAEHSLKENDHARFLQTAKNITERVSMATASSQVLIPEINLNDTFD
TFALDFSREKKLLECLDYLTAPNPPTIREELCTASYDTITVHWTSDDEFSVVSYELQYTI
FTGQANVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXQPFKLDPKSAHRKLKVSHDNLTVERDESSSKKSHTPERFTSQGSYGVAGNVFIDSGR
HYWEVVISGSTWYAIGLAYKSAPKHEWIGKNSASWALCRCNNNWVVRHNSKETPIEPAPH
LRRVGLLLDYDSGSIAFYDALNSIHLYTFDVAFAQPVCPTFTVWNKCLTIITGLPIPDHL
DCTEQLP
Download sequence
Identical sequences ENSDORP00000001376 ENSDORP00000001376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]