SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001429 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001429
Domain Number 1 Region: 508-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000881
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 
Domain Number 2 Region: 602-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000474
Family Classic zinc finger, C2H2 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000001429
Domain Number - Region: 479-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000556
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001429   Gene: ENSDORG00000001532   Transcript: ENSDORT00000001531
Sequence length 1574
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1488:4782:137683:-1 gene:ENSDORG00000001532 transcript:ENSDORT00000001531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQSHSSVTPEKKKAENSIVKCSTRTDVSEKAVASSTTSNEDENPGQIYHRERRNAITM
QPQSEQGLGKLSEEPSTSSDERASLIKKEIHGSLPHLAEPSVPYRGTVFAMDPRNGYVEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHVXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHALSFTYPSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPVPGIPTVLNPVQVSSGPSESSQNKPTSE
SAVSSTGDPLHNKRSKIKPDEDLPSPGGRGQQXXXXXXXXVKEEGDRDESKQEEVIYETC
HWEGCAREFDTDQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRHTGE
KPHKCTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDMHPRPPPPRDPGSHSQAR
SPGRPAPGALGEQTELGIATSKREEGLQVKTVKAEKPMXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVPR
VGSLHGRLPAASTPEDKRTLVLQNYTRPESGPPRHFPASPCPPSISENVALESLAVGADG
DLHEEDFLPDDVVQYLNAQNQAGCGQHFPGAAPDDSKAPQGPGDFDLPGLPDSHPSQQFR
PLEQHCSGGGEGRKSDLPIQWNEVSSGSSDLSSSKPKGGPRPAGTQARALGAYGGMVLQA
QGPWRAGGCPGLGESGGAYAGPEPLAIHGDLGAGPGGSALLDQPYKAPRYGSCLAGQPAS
PGAPDGAPCSAQIQGSKLKGTTAMPGNGVPLDLGLIMAANETAVGTEINLQTPDPRGQGY
PAHPLLGDSLHRQGAGRPGPQRPTPPGATSYTSVYPGPGSSLQGTLSIGSHPTSSTAIRG
YPQPCASYGGSRRQAVPRVGVALQQGQLSDTSQICRVNGIKMETHGPPQPLCSNTQNYSG
QFYDQTLGFGQQDTKTDSFSMAEANCLLQGAHMENSELLSPGANQVTSTVDGLDSHDLEG
VQIDFHAIIDDGDHASLMSGALSPSIMQNLSHSSSRLTTPQAPLPFPALSLSTTNMAIGD
MNSLLTSLAETKFL
Download sequence
Identical sequences ENSDORP00000001429 ENSDORP00000001429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]