SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001630 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001630
Domain Number 1 Region: 98-262
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.45e-33
Family Ankyrin repeat 0.00036
Further Details:      
 
Domain Number 2 Region: 509-570
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.73e-17
Family SAM (sterile alpha motif) domain 0.0063
Further Details:      
 
Domain Number 3 Region: 249-336
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000381
Family SH3-domain 0.0038
Further Details:      
 
Domain Number 4 Region: 5-49
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000622
Family Ankyrin repeat 0.0042
Further Details:      
 
Domain Number 5 Region: 440-489
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000982
Family SAM (sterile alpha motif) domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001630   Gene: ENSDORG00000001740   Transcript: ENSDORT00000001743
Sequence length 1392
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5077:33932:44717:-1 gene:ENSDORG00000001740 transcript:ENSDORT00000001743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLGSTKKINVNFQDPDGFSALHHAALNGNTELITLLLEAQAAVDIKDNKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSEMLIQHQSNPCMVDNSGKTPL
DLACEFGRVGVVQLLLSSNMCAALLEPRPGDATDPNSTSPLHLAAKNGHIDIIRLLLQAG
IDINRQTKAGTALHEAALCGKTEVVRLLLDSGINAQVRNTYSQTALDIVHQFTTSQASKE
IKQLLREASAALQVRATKDYCNNYDLTSLNVKAGDIITVLEQHPDGRWKGCIHDRTGNDR
VGYFPSSLGEAIAKRAGARAGSEPSPPQGGSAAGPSAPPEEIWVLRKPFAGGERSGSLSS
GTGGRSGGGHTLHAGSEGVKLLATVLSQKSTSESSPGDSPVKPSEGPTGSGRPQLPAAHG
GQLYGEQPAKKLEAASEGKSAEAVSQWLATFQLQLYAPNFTNAGYDLPTISRMTSDLTAI
GVTEPGHRXXXXXXXXXXXXXXXXXXXXXANLAVWLSVIGLAQYYKVLVDNGYENIDFIT
DITWEDLQEIGITKLGHHKKLMLAVKKLAETVKDEAKYDVGPLRRKATQSLETTAIESPP
PPEPAPADCQSPKMTTFQDSELSGELQAAMTGPAEAPAEQPSGRLPPTPRAAGRPEPSLG
GRARHMSSSQELLGDGPPGPSSPMSRSQEYLLDEGQCPAPXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNRLGVRQRRRASDLAGSVDTG
SAGSVKSIAAMLELSSIGGGGRGARRPPEGHPTPRPAIPEPGRVATVLASVKHKEAIGPD
GEVVNRRRTLSGPVTGLLAAARRGPGEPTEQGHFVEDGATRQRPRGPAKAEAGAEGPPLA
RVEASATLKRRIRAKQSQQENVKFILTESDTVKRRPKAKEREAGPEPPPPLSVYQNGTAT
VRRRPASEQAGTPELPPPPPPAEPPPADLAHLPPLPLPDGNARKPAKPPVSPKPVLAQPV
PKTQGSPTPASKKVPLPGPGSPEVWRAHGTPPPVSPKPPPPPTAPKPPKVAAGLQSGSAG
PSPAPSPARQPPAALAKPPAAPPAPGASPGAPPSPGAPPPHVPAKPPRAAAAVPSAPHPA
SDGASPGDSARQRLEETSASLAAALQAVEEKIRLEDGQGLGPSTAAKSAGSILDDIGSMF
DDLADQLDAMLE
Download sequence
Identical sequences ENSDORP00000001630 ENSDORP00000001630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]