SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000001956 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000001956
Domain Number 1 Region: 40-283
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.16e-85
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000257
Further Details:      
 
Domain Number 2 Region: 623-785
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.7e-29
Family AlaX-like 0.02
Further Details:      
 
Domain Number 3 Region: 544-619
Classification Level Classification E-value
Superfamily Translation proteins 0.00000000000777
Family AlaX-M N-terminal domain-like 0.0085
Further Details:      
 
Domain Number 4 Region: 347-393
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.00000000863
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000001956   Gene: ENSDORG00000002088   Transcript: ENSDORT00000002089
Sequence length 982
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5696:24957:41050:-1 gene:ENSDORG00000002088 transcript:ENSDORT00000002089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVAAVAGRLRRAIRRSSSWQGPSPRPLSAEPPPAQGSAVRDTFLSFFRDRHGHRLVP
SASVRPRGDPSLLFVNAGMNQFKPIFLGTVDPRSEMAGFRRVANSQKCVRAGGRHNDLQD
VGRDLSHHTFFEMLGNWAFRGEYFKEEACSMAWELLTEVYGIPKDRLWVYFGGDPKAGLD
PDLESRDIWLSLGVPTSRVLSFGPQENFWEMGDTGPCGPCTEIHYDLAGGDGAPQLVELW
NLVFMQHNREADGSLQPLPHRHVDTGMGLERLVAVLQGKRSTYDTDLFSPLLSAIHQXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVLRRILRRAVRFS
TEVLRAPPGFLGSLVPVVVETLGAAYPELQENSAQXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHRA
QQAEPAQEQRLHLDVHALGELQRQGVPPTDDSPKYRYTLQPGGGYEFDPCEAQVLQLYTE
NGTAVASVGAGQRCGLLLDRTNFYAEQGGQASDRGYLVPAGQPDVLFPVSRAHICGGFIL
HEVVAPACLQVGDQVQLHVDEAWRLGCMEKHTATHLLNWALRQTLGPGTEPRGSHLNPER
LRFDLATQTALTPEQLWKVEGAVQEAVGRDEAVYMEEVPLALTAHIPGLRSLDEAYPDPV
RVVSVGVPVAQALEPASQAALHTSMELCCGTHLLRTGAVRDLVIIGERQLAKGTTRLLAV
TGEQAQQARDVGQALAHEVEAASERLSRGTRDLTEAQRLSKDMGRLTEAVDTAVMPQWQR
RELQATLKALQRRANTAVRKLEMGQAAEKSQELLKRHTKGRLIVDTVSAESLSVLVKVVR
QLCAQAPGTSVLLLSPQGSGSVLCACQVAQGTTPAFTAADWALAVCNHMGGKSWGSRLVV
GGSTADLEAALSIARAYALNQI
Download sequence
Identical sequences ENSDORP00000001956 ENSDORP00000001956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]