SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002108 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000002108
Domain Number - Region: 14-52
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0318
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002108   Gene: ENSDORG00000002248   Transcript: ENSDORT00000002247
Sequence length 318
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5614:502:7381:1 gene:ENSDORG00000002248 transcript:ENSDORT00000002247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYYGGEAFSVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGDPN
HVTDDFAAHLTLEHRAPRDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLNDPKM
SETERQSMESERADRSLFVQELLLSTLVREESSDEDERGEMADFGAMGCVDIMPLDVALE
NLNLKESNKGNEPPPPPL
Download sequence
Identical sequences ENSDORP00000002108 ENSDORP00000002108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]