SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002189 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002189
Domain Number 1 Region: 4691-4819
Classification Level Classification E-value
Superfamily SET domain 2.22e-34
Family Histone lysine methyltransferases 0.0059
Further Details:      
 
Domain Number 2 Region: 945-1006
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000153
Family PHD domain 0.0035
Further Details:      
 
Domain Number 3 Region: 333-389
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000244
Family PHD domain 0.0027
Further Details:      
 
Domain Number 4 Region: 895-953
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000244
Family PHD domain 0.012
Further Details:      
 
Domain Number 5 Region: 1019-1086
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000642
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 284-341
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000886
Family PHD domain 0.011
Further Details:      
 
Domain Number 7 Region: 1600-1647
Classification Level Classification E-value
Superfamily HMG-box 0.0000128
Family HMG-box 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002189
Domain Number - Region: 409-463
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000184
Family PHD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002189   Gene: ENSDORG00000002330   Transcript: ENSDORT00000002331
Sequence length 4819
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5697:17671:185142:-1 gene:ENSDORG00000002330 transcript:ENSDORT00000002331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRSRGKTTVEDEDSMDGLEATETETIVETEVKEQSAEEDAEAEVENSKQPAPALQRSVSE
ESANSLVSVGVEAKISEQLCAFCYCGEKSSLGQGDLKQFRVTPGLVLPWKNHPPTKDIDD
NSSGTCEKTQNSAPRKQRGQRKERSPQQNVVSYVSVSTQTASDDQAGKLWDELSLVGLPD
AIDVQALFDPTGTCWAHHRCVEWSLGVCQMEEPSLVNVDKAVVSGSTEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEDANCAVCDSPGDLLD
QFFCTTCGQHYHGMCLDIVVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHT
FCLQPVMKAVPTNGWKCKNCRICVECGTRSSSQWHHNCLVCDTCYQQQDNLCPLCGKCCH
PELQKDLLHCNMCRRWVHLECDKQTDHELDSQLKEEYICLYCKHLGAEVDALLPGDEVEM
AELNADSNTEMEVDRPEDQMAFLEPTIDKDINAKESIPGIVPDAAEVHTEQQQQRPCRPS
ESLGTDGLLITESSLSKMNPDLENDVSPEIGGENTEMPSKVMTVCDEDQNGDKMEVTENM
EELTQEITVRQDDQHLLKEPTVVTAKEAASPPTSTMESVLVPPEALASPSQESISLCSSD
QLLIDRVQAEMEQKENSKFPTGCMDCEMTPSIESCMKDGLCQGDGSINLPSEIESFSSVE
MSKTNTASSPTRSSDLPSHDRLQGYPSTLSSPAGNIMPTTYISVAPKIGMGKPAITKRKF
SPGRPRSXXGAWSTHNTVSPPSWSPDISEGREIFKPRQLPGSAIWSIKVGRGSGFPGKRR
PRGAGLSGRGGRGRSKLKSGLGAVVLPGVSAADISLNKDEEENSMHNTVVLFSSSDKFTL
HQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKGWRCLECTVCEACGK
ATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNY
TQCAPCASLSSCPVCCRNYREEDLILQCRQCDRWMHAVCQNLNTEDEVENVADIGFDCSM
CRPYMPASNVPSSDCCESSLVAQIVTKVKELDPPKTYTQDGVCLTESGMTQLQSLTVTVP
RRKRSKPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGELMDCDGKSESSPERE
AVDDETKGVEGADGVKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRSMIRKDSSGSISEQL
PNRDDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTADDPLADIS
EVLNTDDDILGIISDDLAKSVDHSDIGPIAGDPSSLPQPSVTQSSRPLSEEQLDGILSPE
LDKMVTDGAILGKLYKIPELGGKDVEDLFTAVLSPAASQPTPLPQPPPPPQLLSMHNQDV
FSRMPLMNGLIGPGPHLPHNSLPPGSGLGTFPAVAQSPYADARDKNPAYSAIGSDPNGSW
APSVPAVECENDTMSNAQRSTLKWEKEEALAEMATVAPVLYTNINFPNLKEEFPDWTTRV
KQIAKLWRKASSQERAPYVQKARDNRAALRINKVQMSNDSLKRQQQQDAIDPSVRMDADL
FKDPLKQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQLGSQHLLV
PSGSDTPSSGAQSPLTPQPGSGNMSPAQTFHKDLFSKQLHNTPAPTPSDDVFVKPQAPRA
PVTPSRVPIQETLSQSPSQPPSPQMFSPGSSNPRPLSPMDPYAKMVGTPRPPPGGHSFPR
KNSVTAVENCVPLSSVPRPIQMSETTTSRPSPARDLGSSSTPSSDPYAKPPDTPRPVMTD
QFPKPLGLPRSPLISEQTAKGPLTAGTNDHFTKPPPRTDVFQRQRIPDPYVRPLLTPAPL
DGGPGPFKAPLHPPPSSQDPYGSLSQASRRLSVDPYERPVLTPRPVDNFSHGQSNDPYSQ
PPLTPHPAMSDSFTHSSRAFPQPGTVSRSTSQDPYSQPPGTPRPVIDSYSQPSGTARSNP
DPYSQPPGTPRPTTVDPYSQQPPTPRPSPQTDMFVAPTTNQRHSDPYAHPPGTPRPGISV
SYSQPPATPRPRTSEGFTRSAGARPALVSNQEFLQAAXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXTFSRVSPSARDPYDQPPGTPRPQADSFGTSQVVHDVADQGGPGLEGSFSTSA
NPAMGSQGQQFPSAPQHPGPVPTSGGTDTQNTVNMSQADTEKMRQRQKLREIILQQQQQK
KIASRQEKGPQDTTGMPHPVPLPHWQPESINQAFTRPPPPYPGNVRSPVVPPLGPRYGQR
GPYPPDVAGMGMRPHGFRFGFPGGSHGTMSSQDRFLVPPQQMQGSGIPPHLRRSMSVEMS
RPLSNSAMSNPAGLPQHFPPQGLPVQQHNILGQAFIELRHRAPDGRPRLPFTASPGSMIE
APHPRHGNFVPRPDFPGPRHPDAMRRPPQGLPPQLQAHPDLEPVPPSRQEQSHPVHPTSM
VMRPLNHPLGSEFSEASMSTSAPVETTPDNLHIASQSSDSLEEKLDSDDPSMKELDVKDL
DSVEVKDLDDEDLENLNLDPEDGKGDELDTLGNLETNDPNLDDLLRSGEFDIIAYTDPEL
DLGDKKSMFNEELDLNVPMDDKLDNPCVSLETKKKEQEDKAVVLSDNHSPQKNSTATSEK
IKRETGSPHCKEEARCDIEKGDESKDCVNTPCSQASAQPDLRDGEKTSLLPSGPDLLEKR
TSGESAGSNTSTVQGSSPLPARDGTNTCDIMGSTPVLSRLLANEKTDNSDIRPLGSPPAL
PVSPSSRVASLPPALMPPPGPLLDNSMNSNVTMVSRANHAFSQGVQVNPGFIQAQSTVNH
SVGTGKPTTQNVPLTNPSSTTGMSGPQQLMIPQTLTQQQNRERPLLLEEQPLLLQDLLDQ
ERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVALKGINKVMAQSNLGMPPM
VMNRFPFMGPPVAGPQNTDGQSLVPQAVAQDGSITHQISRPNPPNFGPGFVNDSQRKQYE
EWLQETQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQQ
SMVQKQLEQIRKQQKEHAELIEDYRIKQQQQQQQCALAPPILMPGAPPPLVSGATPPTAS
QPSFPMVPQQLQRQQHTPVISGHTSPARMPGLPGWQPASTPAHLPLNPPRIPPPITQLPI
KTCTPAPGTVSNTNPQGGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVD
RQRALQQRMEMEQHGLIGSELGNRSSVSQMPFYPSDRPCDFMQPPRPLQQSPQHQQQMGP
ALQQSVQQGSVSSPPTQTFMQTSERRQVGPPSFVPDSPSIPGGSPNFHSAKQQGHGSVPG
TSFQQSPLRSPFTPALPGTPPVANSSLPCGQDPATAHGQCYPGSTPSLIQLYSDIIPEEK
GKKKRARKKKKDDDAESTKAPSTPHSDITAPPTPGISERTSTPSMSTPSELPPQGEQEAP
EPVGPSTPGTATGQPCSQLENKLPGSDFSQGAPGHHTNENSEVDKLSTETPATSEEIKLE
KSETEPCLSQEETKLEEQGDSKVEEDIAADPGSSVHSPSHSAAAPAAKGDSGNELLKHLL
KNKKSASLLSQRPEGTFCPEDSCPKENKLAEKQSPVEGLQTLGAQMQSGFGCGNSQLPKS
DGGNETKKQRSKRTQRTGERAAPRSKKRKKDEEEKHVMFSNSDSFTQLKQQNNLSNPPTP
PASLPPTPPLMACQKMANGFATEELARKAGVLVSXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXIQDHCGDRDTPDSFVPSSSPESVVGVEVSRYPDL
SQVKEEPPEPVPSPIIPILPSITGKSSESRRNDIKTEPGTLFFTSPFGSSPNGPRSGLIS
VAITLHPTAAENISSVVAAFSDLLHVRIPNSYEVSNAPDVPSMGLVNSHRVNPGLEYRQQ
LLLRGPPPGSANPPRLASSYRLKPPNVPFPPTSNGLSGYKDSSHGVTESGVLRPQWCCHC
KVVILGSGVRKSFKDLAFANKDSRESIRRMEKDIVFCSNNCFILYSSTTQAKNPESKEPI
PSLPQSPLREMPSKAFHQYSNNISTLDVHCLPKFQEKASPPPSPPIAFPPAFEAAQVEAK
PDELKVTVKLKPRLRTVHGGLEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDE
FLRKLGTSLKPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYE
TQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTM
LCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQL
LPQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVVIRIVXXXXXX
XXXXXXXXXXVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVE
ACENYSFRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTV
TGELNAPYSKQFVHSKSSQYRRMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIG
TIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTF
ERGHKIIISSNRRIQKGEE
Download sequence
Identical sequences ENSDORP00000002189 ENSDORP00000002189

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]