SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002263 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002263
Domain Number 1 Region: 711-779,818-907
Classification Level Classification E-value
Superfamily RUN domain-like 5.23e-33
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 1067-1226
Classification Level Classification E-value
Superfamily RUN domain-like 6.67e-23
Family RUN domain 0.014
Further Details:      
 
Domain Number 3 Region: 915-1012
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 2.06e-18
Family Lipoxigenase N-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002263   Gene: ENSDORG00000002408   Transcript: ENSDORT00000002409
Sequence length 1227
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5962:7586:67771:-1 gene:ENSDORG00000002408 transcript:ENSDORT00000002409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCQYIQASKARDGASPFISSTTEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYQRLMTVAETITALMFPFQW
QHVYVPILPASLLHFLDAPVPYLMGLHSNGLDDRSKLELPQEXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXK
AIELRLAKIDHTAVHPHLLDMKIGQGKYEPGFFPKLQSDVLSTGPASNKWTKRNVPAQWR
RKDRQMQHTEHLRLDNDQREKYIQEARNMGSTIRQPKLSNLSPSVIAQTNWKFVEGLLKE
CRNKTKRMLVEKMGREAVELGHGEVNITGVEENTLIASLCDLLERIWSHGLQVKQXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLLLDSRRSDASAAMSPLRISLIQDMRHIQNIGEIKTD
VGKARAWVRLSMEKKLLSRHLKQLLSDHELTKKLYKRYAFLRCDDEKEQFLYHLLSFNAV
DYFCFTNVFTTILIPYHILIVPSKKLGGSMFTANPWICISGELGETQILQIPRNVLEMTF
EYQNLGKLTTVQIGHDNTGLYAKWLVEYVMVRNEITGHTYKFPCGRWLGKGMDDGSLERV
LVGELLTSLPEVDERPCRTPPLQQSPSVIRRLVTISPNNKPKLNTGQIQESIGEAVNGIV
KHFHKPEKERGSLTLLLCGECGLVSALEQAFQHGFKSPRLFKNVFIWDFLEKAQTYYETL
EQNEVVPEENWHTRARNFCRFVTAINNTPRNIGKDGKFQMLVCLGARDHLLHHWIALLAD
CPITAHMYEDVALIKDHTPVIPLIRVL
Download sequence
Identical sequences ENSDORP00000002263 ENSDORP00000002263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]