SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002435 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002435
Domain Number 1 Region: 41-140,207-320
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-41
Family Ankyrin repeat 0.00068
Further Details:      
 
Domain Number 2 Region: 409-719
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.78e-39
Family Patatin 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002435   Gene: ENSDORG00000002589   Transcript: ENSDORT00000002592
Sequence length 732
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1071:26326:49605:-1 gene:ENSDORG00000002589 transcript:ENSDORT00000002592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFQLESEADAQVNFQQYSSQLPPFYESSTQVLQVDVLQQLTDLIRNHPSWSAAHLAVELG
IRECFHHSRIISCANNTENEEGCTPLHLACRKGNGEILVELVQYCHAQMDVTDNKGETAF
HYAVQGDNSQVLQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXCAEMIISMDSNQIHSKDPRYAPLHWAKNAEMARMLLKRGCEVES
TSASGNTALHVAVMRNRFDCVMVLLTYGANAGARGENGNTPLHLAMSNDNLDLVKALIVF
GAEVDVPNDFGETPALIASKISKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXLQDLLPISRARKPAFILSSMRDEKRTHDHLLCLDGGGVKGLV
IIQLLIAIEKASGMATKDLFDWVAGTSTGGILALAILHSKSMAYMRGVYFRMKDEVFRGS
RPYESGPLEEFLKREFGEHTKMTDVKKPKVMLTGTLSDRQPAELHLFRNYEAPEAVREPR
FTQNVNLKPPTHPSDQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEFN
QDMIRKGQGSKVKKLSIVSLGTGRSPQVPVTCVDVFRPSNWELAKTVFGAKELGKMVVDC
CTDPDGRAVDRARAWCEMVDIQYFRLNPQLGMDIMLDEVSDAVLVNALWETEVYIYEQRE
QFQKLVQLLLAP
Download sequence
Identical sequences ENSDORP00000002435 ENSDORP00000002435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]