SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002511 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002511
Domain Number 1 Region: 122-360,403-480,525-618
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 5.13e-120
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000303
Further Details:      
 
Domain Number 2 Region: 602-725
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.25e-30
Family Anticodon-binding domain of Class II aaRS 0.00029
Further Details:      
 
Domain Number 3 Region: 71-106
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000471
Family a tRNA synthase domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002511   Gene: ENSDORG00000002672   Transcript: ENSDORT00000002673
Sequence length 739
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6305:3617:41991:1 gene:ENSDORG00000002672 transcript:ENSDORT00000002673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLRPALLEAVRVVLWPPLSLRPPVRVPLVPRRSLSARAPASFPAAAALASRSSMDGAS
AEEVLAPLRLAVRQQGDLVRKLKEDKAPQVDVDKAVAELKARKRVLEAKELALQPKDDII
DRTKMEDTLKRRFFYDQAFAIYGGVSGLYDFGPVGCALKNNIIQTWRQHFIQEEQILEID
CTMLTPEPVLKTSGHVDKFADFMVKDVKSGECFRADHLLKAHLQKLMSDKKCSAEKKSEM
ESVLAQLDNYGQQELGDLFVNYNVKSPTTGNDLSPPVPFNLMFKTFIGPGGNMPGYLRPE
TAQGIFLNFKRLLEFNQGKLPFAAAQIGNSFRNEISPRSGLIRVREFTMAEIEHFVDPNE
KDHPKFQNVADLYLYLYSAKAQVSGQSARKMRLGDAVEQGVINNSVLGYFIGRIYLYLTV
GVSPDKLRFRQHMENEMAHYACDCWDAESXXXXSWIEIVGCADRSCYDLSCHAKATKVPL
VAEKPLKEPKTVNVVQFEPSKGAVGKAYKKDAKLVMEYLAACDECYITEMEMLLNEKGEF
TVETEGKTFQLTKDMVSVKRFQKTLYVEEVVPSVIEPSFGLGRIMYTVLEHTFHIREGDE
QRTFFSFPAMVAPFKCSVLPLSQNQEFMPFVKELSEALTKNGVSHKVDDSSGSIGRRYAR
TDEIGVAFGITIDFDTVNKTPHTATLRDRDSMRQIRAEVSELPIVVRNLANGSITWADVE
ARYPLFEGQETGKKETIEE
Download sequence
Identical sequences ENSDORP00000002511 ENSDORP00000002511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]