SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002603 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002603
Domain Number 1 Region: 12-195
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 7.6e-58
Family Crystallins/Ca-binding development proteins 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002603   Gene: ENSDORG00000002775   Transcript: ENSDORT00000002773
Sequence length 196
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5318:73217:75830:-1 gene:ENSDORG00000002775 transcript:ENSDORT00000002773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSAPAPGPAPACLTLWDEEDFQGRCCRLLSDCANISERDLRRVRSVKVESGVWVAFEYP
DFQGQQFILEKGDYPRWSAWSGSSGHPSNQLLSFRPVLCANHSDSRVTLFEGENFRGCKF
ELNDDYPSLPSMGWTSKDVGSIKVSSGAWVAYQYPGYRGYQYVLEQDRHSGEFRTYGEFG
TQAHTGQLQSIRRVQH
Download sequence
Identical sequences ENSDORP00000002603 ENSDORP00000002603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]