SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002702 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002702
Domain Number 1 Region: 334-410
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 3.64e-19
Family Blood coagulation inhibitor (disintegrin) 0.00053
Further Details:      
 
Domain Number 2 Region: 176-277
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.24e-17
Family Reprolysin-like 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002702
Domain Number - Region: 565-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00109
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002702   Gene: ENSDORG00000002878   Transcript: ENSDORT00000002879
Sequence length 650
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4475:47900:57590:1 gene:ENSDORG00000002878 transcript:ENSDORT00000002879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLLSSQYVERFSREGTTQHSTGAGDHCYYQGKLRGNPHSFAALSTCQGLHGVFSDGNLTY
IVEPQEMAGPWGAPHGPLPHLIYRTPLLPAPLGCREPXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLTRIVL
VAMETWADGDKIQVQDDLLETLSRLMVYRREGLPEPSDATHLFSGAYVGGICSLSRGGGV
NEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSADCCPDXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKKCTL
THDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCDHEQ
GRCYGGRCKTRDRQCQALWGHVAADRFCYEKLNVEGTERGNCGRKGSGWVQCNKQDVLCG
FLLCVNISGAPRLGDLGGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACGPNM
LCLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLPTSP
PTGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRSGGA
Download sequence
Identical sequences ENSDORP00000002702 ENSDORP00000002702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]