SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002805 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002805
Domain Number 1 Region: 202-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.64e-20
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 2 Region: 258-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-19
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 314-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 148-202
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-18
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 5 Region: 359-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 6 Region: 538-590
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-16
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 7 Region: 80-129
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000125
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 8 Region: 506-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000407
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002805
Domain Number - Region: 18-43,78-92
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00362
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002805   Gene: ENSDORG00000002985   Transcript: ENSDORT00000002985
Sequence length 615
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1326:22068:24734:-1 gene:ENSDORG00000002985 transcript:ENSDORT00000002985 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVEAAEARAPAPGYKRSGRRYKCLSCTKTFPNAPRAARHAATHAPADCSEEVAEVKPKAD
TEPKAEEAGGDKVSGSAAKPRPYACPLCPKAYKTAPELRSHGRSHTGEKPFPCPECGRRF
MQPVCLRVHLSHAGELPFRCAHCPKYGALSKLKIHQRGHTGERPYACADCGKSFADPSVF
RKHRRTHAGLRPYGCERCGKAYAELKDLRNHERSHTGERPFLCSECGKSFSRSSSLTCHQ
RIHAAQKPYRCPACGKGFTQLSSYQSHERTHSGEKPFLCPRCGRMFSDPSSFRRHQRAHE
GVKPYRCEKCGKDFRQPADLAMHRRVHTGDRPFKCLQCDKTFVASWDLKRHALVHSGQRP
FRCEECGRAFAERASLTKHSRVHSGERPFHCNACGKSFVVSSSLRKHERTHRSSSSEAAG
AAPQQELVVGLALPVGVEGPAAPGAALGDPPAGLLGLPPESAGVMATQWQVVGMTVEHVE
CLNAGGAEAPGPMGETGEVGGGEETDEKPPQFACRECKETFSTLTLLRRHERSHPELRPF
ACTQCGKSFSDRAGLRKHSRTHSSVRPYACPHCPKAFLSASDLRKHERTHPAPIETPAPL
EPLVALLGMPEEGPA
Download sequence
Identical sequences ENSDORP00000002805 ENSDORP00000002805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]