SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002834 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002834
Domain Number 1 Region: 872-952
Classification Level Classification E-value
Superfamily E set domains 6.58e-21
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000702
Further Details:      
 
Domain Number 2 Region: 1517-1621
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000106
Family Motor proteins 0.049
Further Details:      
 
Domain Number 3 Region: 1066-1162
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000278
Family Ankyrin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002834   Gene: ENSDORG00000003017   Transcript: ENSDORT00000003017
Sequence length 1671
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5341:770:242247:1 gene:ENSDORG00000003017 transcript:ENSDORT00000003017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRAEGKWLPKTSRKSVSQSVFCGTSTYCVLNTVPPLEDDHGNSNSSHVKIFLPKKLLEC
LPKCSSLPKERHRWNTNEEIAAYLITFEKHEEWLTTSPKTRPQNGSMILYNRKKVKYRKD
GYCWKKRKDGKTTREDHMKLKVQGVECLYGCYVHSSIIPTFHRRCYWLLQNPDIVLVHYL
NVPAIEDCGKPCGPILCSINTDKKEWAKWTKEELIGQLKPMFHGIKWTCNNGNSISGFSV
EQLVQQILDSHQTKPQPRTHNCLCTGSLGAGSSVHHKCNSAKHRIISPKVEPRSGGYGGH
AEVQHNDVSEGKHEPGHGKSAGREKRNGKVAKPALLHQNSTEVSSTNQVEVPDTTQSSPV
SISSGLNSDPDMVDSPVVTGVSSMAVASVMGGLSQSATVFMSEVTSEAVYTMSPTAGPNH
HLLSPDASQGLVLAVSSDGHKFAFPTTGSSESLSMLPSNVSEELVLSTTLDGGRKIPETT
MNFDPDCFLNNPKQGQTYGGGGLKVEMVSANIRHSPPAERSFGFTSVLTKEIKTEDTSFE
QQMAKEAYSSAAASAGSGALTLTAGSSLLPSGGGLSPSTTLEQMDFSAIDSNKDYASSFS
QAGHSPHIHQTPSPSFFLQDTGKPLPLEQNAHGGLSESGGAFVMPTVKTEASSQTSSCSG
HVEPRMGSASSLHLMQFQANFQAMTADGEVTMETSQAAEGGEVLLKSGELQACGSEHYLQ
PESNGVIRTAGGVPILQSNVVQGLYPVAQPSLGHASNMELSLDHFDISFSNQFSDLINDF
ISVEGGSSTIYGHQLVSGDSAALSQSEDGARAPFAQAEMCVPCCSPQQGSLQLSSAEGGA
GTMAYMHVAEVVSAASAQGTLGILQQSGRLFMVTDYSPEWSYPEGGVKVLITGPWQEASN
NYSCLFDQISVPASLIQPGVLRCYCPAHDTGLVTLQVAFNNQIISNSVVFEYKARALPTL
PSSQHDWLSLDDNQFRMSILERLEQMERRMAEMTGSQQHKQAGGGGSSGGGSGSGSGASQ
AQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLLHQAAAQSYATL
IQTLIKWRTKHADSIDLKLEVDPWNVDHFCTPMWACALGHLEAAVVLYKWDRRAISIPDS
LGRLPLGIARSRGHVKLAECLEHLQRDEQAQLGQNPRIHCPPSEEPSTESWMAQWPSEAM
SSPEIPKGVTVIASTNPELRRPRSEPSNYYSSESHKDYPAPKKHKLNPEYFQARQEKLLS
TALSLEQPNIRKQSPSSKQSAPEPMSPSEGVRDCSRETSPPTAETAAFQASGSHPVVKWS
SKDLYIGVSTVQVTGNPKGTSVGKDAAPSQVRPREPMSVLMMANREVVTTETGAYRDGAE
HVGCSPPVDDIQVNMMTLAEHIIEATPDRIKQENFVPMESSAVERTDPASISSTMSWLAS
YLADADRLPSAAQIRSAYNEPLTPSSNTSMSPVGSPVSEIAFEKPNLPSAADWSEFLSAS
TSEKVENEFAQLTLSDHEQRELYEAARLVQTAFRKYKGRPLREQQEVAAAVIQRCYRKYK
QYALYKKMTQAAILIQSKFRSYYEQKKFQQSRRAAVLIQKYYRSYKKCGKRRQARRTAVI
VQQKLRSSLLTKKQDQAARKIMRFLRRCRHSPLVDHRLYKRSERIEKGQGT
Download sequence
Identical sequences ENSDORP00000002834 ENSDORP00000002834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]