SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002877 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002877
Domain Number 1 Region: 79-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-45
Family SPRY domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002877   Gene: ENSDORG00000003065   Transcript: ENSDORT00000003064
Sequence length 252
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_5555:5:9779:1 gene:ENSDORG00000003065 transcript:ENSDORT00000003064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEALQKLDTIRTSLVGLLTHLDDIQLIQKEQEIFERTEEAEGILDPQESEKLNFNEKCTR
SPLLTQLWATAVLGSLSGMEDVRIDEKTVSPLLQLSDDRRTVTFSAKKPKACVDGPERFD
HWPNALAATSFQEGLHAWVVNVQNSCAYKVGVASGQLPRKGSGNDCRLGHNEFSWVFSRY
DQEFRFLHNGQHEPLGLLQCPAQLGVLLDLQAGELLFYEPASGTVLFTFHTSFPTPLFPV
FAVADQTISIIH
Download sequence
Identical sequences ENSDORP00000002877 ENSDORP00000002877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]