SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002940 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002940
Domain Number 1 Region: 613-868
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-56
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 2-201
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-41
Family YWTD domain 0.00000771
Further Details:      
 
Domain Number 3 Region: 916-1174
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-39
Family YWTD domain 0.0000389
Further Details:      
 
Domain Number 4 Region: 870-917
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000628
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 1306-1344
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 568-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000115
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 7 Region: 1228-1266
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 8 Region: 1268-1304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 9 Region: 1185-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000706
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002940
Domain Number - Region: 497-551
Classification Level Classification E-value
Superfamily YWTD domain 0.000353
Family YWTD domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002940   Gene: ENSDORG00000003138   Transcript: ENSDORT00000003140
Sequence length 1597
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_512:7420:62102:-1 gene:ENSDORG00000003138 transcript:ENSDORT00000003140 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APLLLYANRRDLRLVDATHGKENATVVVGGLEDAAAVDFVFGQGLIYWSDVSEESIKRTE
LNKTESVQSVVVSGLLSPDGLACDWLGEKLYWTDSETNRIEVSNLDGSLRKVLFWQELDQ
PRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRLIIINTDIYWPNGLTLDYEERKLYWA
DAKLNFIHKSNLDGTNRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVH
KRSAERETIIDQLPDLMGLKATSVHRIIGSNPCAEENGGCSHLCLYRPQGLRCACPIGFE
LISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEASALDFDVTDNRIYWT
DISLKXISRAFMNGSALKHVVEFGLDYPEGMAVDWLGKNLYWADTGTNRIEVSKLDGQHR
QVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGGERTTLVPNVGRANGLTID
YAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQYQDYIYWTDWSRRSIERAN
KTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHCSHLCLAVPVGGFVCGCPAH
YSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILPIHSLRNVRAIDYDPLDKQL
YWIDSRQNVIRKAQEDGSQGFTVVVSSVSSQNLEIQPYDLSIDIYSRYIYWTCEAANVIT
VTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERSPKIERAALDGTEREVLFFS
GLSKPVALALDSRLGKLFWADSDLRRIESSDLSGANRIVLEDSNILQPVGLTVFENWLYW
IDKQQQMIEKIDMTGREGRTKVQARIAQLSAIHAVKELNLQEYRQHPCAQDNGGCSHICL
VKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQHFTCFTGEIDCIPVAWRCDGFTECEDH
SDELNCPVCSESQFQCASGQCIDGSLRCNGDANCQDTSDEKNCEVLCLIDQFRCANGQCI
GKHKKCDHHVDCGDKSDELDCYPTEEPAPQATNTVGSVIGVIVTIFVSGTIYFICQRMLC
PRMKGDGETMTNDYVVPGPASVPLGYVPHPSSLSGSLPGMSRGKSMISSLSIMGGSSGPP
YDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTMEFGYSSNSPSTHRSYSYRP
YSYRHFAPPTTPCSTDVCDSDCAPSRRVASVASAATAKGYTSDLNYDSEPAPPPPTPRSQ
YLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSDORP00000002940 ENSDORP00000002940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]