SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003007 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003007
Domain Number 1 Region: 1-255
Classification Level Classification E-value
Superfamily L domain-like 1.25e-53
Family Ngr ectodomain-like 0.0049
Further Details:      
 
Domain Number 2 Region: 195-428
Classification Level Classification E-value
Superfamily L domain-like 3.78e-18
Family Ngr ectodomain-like 0.029
Further Details:      
 
Domain Number 3 Region: 639-761
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000000000384
Family Rhodopsin-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003007   Gene: ENSDORG00000003213   Transcript: ENSDORT00000003213
Sequence length 882
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6648:3612:50854:-1 gene:ENSDORG00000003213 transcript:ENSDORT00000003213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTVPS
EAIHGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQAL
TLALNKISSIPDFAFTNLSSLVVLHLHNNKIKRLSHHCFDGLDNLETLDLNYNNLEEFPQ
AIKALPSLKELGFHSNSISVIPDGAFGGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHSLV
IRGASMVQKFPNLTGTIHLESLXXXXXXXXXXXXXXXXXXXXXXXXDLSYNNIRDFPSFN
GCHALEEISLQRNQIHQIKENTFQGLANLRILXXXXXXXXXXXXXXXXXXXXXXXXDVSF
NELTSFPTEGLNGLNQLKLVGNFKLKDPLSAKDFANLRSLSVPYAYQCCAFWGCDSYAHL
NTEDNSLQDHSVTKDKGTADAMFTSSNEHSQIICTPSSAFKPCEYLLGSWMIRLTVWFIF
LVALFFNLLVIVTTFASCTSLPSSKLFIGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTLVLLNSLAFLLMAVIYTKLY
CNLEKEDLSENSQSGMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPEIMKSVTLIF
FPLPACLNPVLYVFFNPKFKEEWKLLKHRVTKKSGSVSVSISSQGGCVEPDFYYDCGVYS
DLQGNLTVCDCCESFLLTKPVSCKHFIKSHSCPALAVASCQRPEGYWSDCGTQSAHSDYA
DEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD
Download sequence
Identical sequences ENSDORP00000003007 ENSDORP00000003007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]