SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003124 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003124
Domain Number 1 Region: 83-274
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000912
Family HspBP1 domain 0.061
Further Details:      
 
Domain Number 2 Region: 606-670
Classification Level Classification E-value
Superfamily PH domain-like 0.000000369
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003124   Gene: ENSDORG00000003341   Transcript: ENSDORT00000003341
Sequence length 724
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6862:13186:682079:-1 gene:ENSDORG00000003341 transcript:ENSDORT00000003341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPADIVKVAIEWPGAYPKLMEIDQEKKMSAIIKEVCDGSSLANHECFALQHADSSNFY
ITEKNRNEIKNGTILRLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDITFAQEF
INLDGISLLTQMVESGTDQYQKLQKIMKPCFGDMLSFTLMAFVELIDHGIVSDTFSVAFI
KKIASFVNKSMDISILQRSLAILESMVLNSHDLYQKVAQEITIGQLIPHLQGTDQEIQTY
TIAVINALFLKAPDERRQEMANILAQKQLCSIILTHVILAQRAINNEMAHQLYVLQVLTF
NLLEDRMMTKMDPQDQAQRDIIFELRRIAFDAETEPNNSSSSLEKRKSMYTRDYKKLGFI
NHVNPAMDFTQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIELTK
MLCEILKVGELPSECNDFHPMFFTHDRSFEEFFCICIQLVNKTWKEMRATSEDFNKVMQV
VKEQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILELKEKIQPE
ILELIKQQRLNRLVEGTCFRKLNARRRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSVLYDSNCQLNFIAPDKHEYC
IWTDGLNALLGKDMMSELTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFV
YDCN
Download sequence
Identical sequences ENSDORP00000003124 ENSDORP00000003124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]