SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003140 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000003140
Domain Number - Region: 162-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00226
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003140   Gene: ENSDORG00000003359   Transcript: ENSDORT00000003358
Sequence length 493
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_766:55291:83192:-1 gene:ENSDORG00000003359 transcript:ENSDORT00000003358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPASGFVPSAGWLPAPEMNPTVGPLRNTASPQGSWALWAMLPPPPPLSPPVDGSKPSS
EAQLAGDTQPLSGAPPPFDAHILPGAQPPFDAKYPLDSQPQLSGQPSWDFRASTSWYWRQ
SPDGFPWHQNAHNFPVKNSYFPRKYGTKFTDFNFPPNKKQKKKKRKEPVFHFFCDTCDRG
FKNQEKYDTHMSEHTKCPEADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXNYPTLSNIERKKKLKLEKEKRGEVLTTTQYGXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSDKEEKPPQTVIPKEVTPALC
SLMSSYGSLSGSESEPEETPIKTEADIVAENQALQSTAPKSPSKNAVATVQNSSGAQCGS
TKKSFRNTNPKKKKNIRNYQTLFEPRTHHPYLLEMLLAPDIRHERNVILQCVRYIIKKDF
FGLNINSEKTKDV
Download sequence
Identical sequences ENSDORP00000003140 ENSDORP00000003140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]