SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003251 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003251
Domain Number 1 Region: 271-345
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000000179
Family Rhamnogalacturonase B, RhgB, middle domain 0.022
Further Details:      
 
Domain Number 2 Region: 69-144
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000000844
Family Rhamnogalacturonase B, RhgB, middle domain 0.017
Further Details:      
 
Domain Number 3 Region: 906-994
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000589
Family Carboxypeptidase regulatory domain 0.017
Further Details:      
 
Domain Number 4 Region: 825-897
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000922
Family Rhamnogalacturonase B, RhgB, middle domain 0.037
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003251
Domain Number - Region: 752-811
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00204
Family Cna protein B-type domain 0.0097
Further Details:      
 
Domain Number - Region: 157-241
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0275
Family Rhamnogalacturonase B, RhgB, middle domain 0.028
Further Details:      
 
Domain Number - Region: 6-57
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0981
Family Cna protein B-type domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003251   Gene: ENSDORG00000003473   Transcript: ENSDORT00000003473
Sequence length 1205
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1307:2185:40842:1 gene:ENSDORG00000003473 transcript:ENSDORT00000003473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKYKHGTKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTSVELYVDGVSDICTK
GGDINFVFTGFSVNGKVLSRGQPLGPAGVQVSLRGTGTEGKIQSTVTQPGGKFAFFKVLP
GDYEILATHPTWALKEASTTVRVTNSNANAAGPLIVAGYNVSGSVRSDGEPMKGVKFLLF
SSSVTKEDVLGCNVSPVPGFQPQDESLVYLCYAVSKEDGSFSFYSLPSGGYAVVPFYRGE
RITFDVAPSRLDFTVEHDSLRIEPVFHVMGFSVTGRVLNGPEGEGVPEAVVTLNNQIKVR
TKTDGSFRLENITTGTYTIHAQKEHLHFETITIKIAPNTPQLADIIATGFSVCGHITIAR
FPDAVKQMSKYKVVLSPQDKDKALVTAEADAHGSFCFKAKPGAYKVQVVVPEAETRAGLM
LKPQMFPLTVTDRPVMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSG
KVNSMTFTFDNVLPGKYKASIMHEDWCWKNKSLEVEVLEDDVLAVEFRQTGYMLRCSLSH
AITLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVYKVTPRSCHRFEQAFYTYDTSSPSI
LTLTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSAQELRREQQLAEIETRR
QEREKNGKEEGEEGRAKPPGQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPS
MEATVSGGSCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAY
SVGPLHSDLEYTVTSQKEGYVLTAVDGTVGDFKAFALAGVSFEIKAEDDQPLPGVLLSLS
GGVFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQSLRITITGYR
TAYSCYGTVSSLNGEPEQGVAVEAVGQKDCSIYGEDTMTDEEGKFRLRGLLPGCVYHVQL
KAEGNDHIERALPHHRVVEVGNNDIDDVNIIVFRQINQFDLSGNVITPSEYLPTLWVKLY
KSENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYVLPQVSFTAVGYH
KHITLIFNPTRKLPEQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXQKTRRTTRWWEALRPGWAAALWRVPPPPPASPPPSPLQEVAA
SAHRQ
Download sequence
Identical sequences ENSDORP00000003251 ENSDORP00000003251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]