SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003292 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003292
Domain Number 1 Region: 455-781
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.24e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000279
Further Details:      
 
Domain Number 2 Region: 791-916
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.11e-17
Family Ricin B-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003292   Gene: ENSDORG00000003518   Transcript: ENSDORT00000003518
Sequence length 919
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3070:58865:99171:1 gene:ENSDORG00000003518 transcript:ENSDORT00000003518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKVRKFFRGSGRVLAFIFVASVIWLLFDMAALRLSFSEINTRVLKEDILKREHIGFRVQ
PDQMILYSSIREMRPPPRGPGKRGWGKENFRKMDEGALNVEDDLGHAEQERKIQKSPRRG
KIMSLWHPAHPQTLPVTPIGQKAEGRDSKPEVPTPQVTLKPAHVKISVHTGPTGVKQKGP
KTHSLSHDTTKQAAEKDLNVTINLKADRSKQQSQAVITNRTHPASSPALGFRKAIGLNET
ETQSKELKANKYKTHTDLPFITLMADGLKKHPINEILLRGLPKDDGAIVAPGRKGNVSES
QIVIITKEEELKTYTKPVSNSQTKTVFPKVLGRSQAKSSSRSRSDISFTSSALWRSTVSQ
SKRVLARGPRPARINVTVKAKPAQQNQNHAKTLLPENHGKHPVLRIDVTLSPRDPKAPGQ
FGRPVLVPSGKEKEAERRWKEGNFNVYLSDLIPVDRAIEDTRPVGCAQQQVHNNLPTTSV
IMCFVDEVWSTLLRSVHSVLNRSPSHLIKEILLVDDFSTKDYLKGNLDKYMSQYPKVRIL
RLKERHGLIRARLAGAQNATGDVLTFLDSHIECNVGWLEPLLERIYLSRKKVACPVIEVI
NDKDMSYMTVDNFQRGIFTWPMNFGWRTIPPDVVAKKKIKETDIIRCPVMAGGLFSIDKN
YFFELGTYDPGLDVWGGENMELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKT
VDDLVRVAEVWMDEYKDLFYGHGDHLINQGLDVGNLTQQRQLRKKLKCKSFKWYLENVFP
DLQAPVVRAGGVLINVALGKCISIENFTAVLGDCDASSKYQQFNYTWLRLIKHGEWCLAP
ITDKGSLTLHPCEAKNKEFRWLHKAPSFFHPELMSHVVFENYHQLLCLEGNFSQKTLKVS
TCDQKKPYQKWKFEKYYDE
Download sequence
Identical sequences ENSDORP00000003292 ENSDORP00000003292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]