SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003317 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003317
Domain Number 1 Region: 203-466
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.52e-82
Family Nuclear receptor ligand-binding domain 0.000000000288
Further Details:      
 
Domain Number 2 Region: 98-182
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.46e-27
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003317   Gene: ENSDORG00000003547   Transcript: ENSDORT00000003547
Sequence length 467
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_7031:22697:35768:-1 gene:ENSDORG00000003547 transcript:ENSDORT00000003547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDTESLICPLSPLETEDLESPLSEEFLQEMGSIQEISQSIGEESSGSFSFTDYQYLGSGP
SSDGSVITDTLSPASSPSSVSCPAVPGSTDEPPSGALNIECRICGDKASGYHYGVHACEG
CKGFFRRTIRLKLVYDRCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEK
AKLKAEILTCEHDAEGSEAADLKSLAKKIYEAYLKNFNMNKVKARVILAGKTNNNPPFVI
HDMETLCMAEKTLVAKMLANGIQNKEVGVRIFHCCQCMSVETVTELTEFAKAIPGFANLD
LNDQVTLLKYGVYEAIFTMLSSLMNKDGMLVAYGSGFITREFLKTLRKPFCDILEPKFDF
AMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDTF
LFPKLLQKMVDLRQLVTEHAQLVQVIKKTESEAPLHPLLQEIYKDMY
Download sequence
Identical sequences ENSDORP00000003317 ENSDORP00000003317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]