SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003978 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003978
Domain Number 1 Region: 359-442,493-572
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.09e-35
Family Nuclear receptor ligand-binding domain 0.00085
Further Details:      
 
Domain Number 2 Region: 93-164
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-25
Family Nuclear receptor 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003978   Gene: ENSDORG00000004257   Transcript: ENSDORT00000004257
Sequence length 585
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2255:1945:25022:-1 gene:ENSDORG00000004257 transcript:ENSDORT00000004257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVTEQQTGQKIQIVTALDHNTQGKQFILTNHDGSAPSKVILARQDATPGKVFLTAPDAGG
VNQLFFTTPDLSTPQLQLLTDNSSPDQGPNKTFELCVVCGDRASGRHYGAVTCEGCKGFF
KRSIRKNLVYSCRGSKDCVINKHHRNRCQYCRLQRCIAFGMRDXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXAFDTLAKALNPGESTSCQSSVEGVEGSIHLIAGDSSINYIEKEGPLLSDSHVAFRL
TMPSPMPEYLNVHYIGESASRLLFLSMHWALSIPSFQALGQENSISLVKAYWNELFTLGL
AQCWQVMNVATILATFVNCLHSSLQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXHPGLVNMEQIEKFQEKAYVEFQDYITRTYPDDTYRLSRLLLRLPALR
LMNATITEELFFKGLIGNVRIDSVIPHILKMEPADYNSQIIGHST
Download sequence
Identical sequences ENSDORP00000003978 ENSDORP00000003978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]