SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004053 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004053
Domain Number 1 Region: 182-498
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.24e-85
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000523
Further Details:      
 
Domain Number 2 Region: 1022-1289
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 8.29e-53
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000001
Further Details:      
 
Domain Number 3 Region: 1292-1425
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 6.22e-27
Family Anticodon-binding domain of Class II aaRS 0.00018
Further Details:      
 
Domain Number 4 Region: 535-611
Classification Level Classification E-value
Superfamily Ribosomal protein L25-like 3.87e-17
Family Gln-tRNA synthetase (GlnRS), C-terminal (anticodon-binding) domain 0.012
Further Details:      
 
Domain Number 5 Region: 51-163
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.97e-17
Family Glutathione S-transferase (GST), C-terminal domain 0.04
Further Details:      
 
Domain Number 6 Region: 905-955
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00000000000000746
Family a tRNA synthase domain 0.00045
Further Details:      
 
Domain Number 7 Region: 1478-1516
Classification Level Classification E-value
Superfamily C-terminal domain of ProRS 0.00000216
Family C-terminal domain of ProRS 0.012
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004053
Domain Number - Region: 848-878
Classification Level Classification E-value
Superfamily S15/NS1 RNA-binding domain 0.00239
Family a tRNA synthase domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004053   Gene: ENSDORG00000004335   Transcript: ENSDORT00000004335
Sequence length 1516
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3076:7477:71332:-1 gene:ENSDORG00000004335 transcript:ENSDORT00000004335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKLCLTVNPGDPPLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVVFTDVNSILRYLAR
VATTAGLYGTNLMEHTEIDHWLEFRSTKLPSCNLFTSAINELNHCLSLRTYLVGNSLTLA
DLCVWATLKGSAAWQEQMKQNKAPVHVKRWFGFLEAQQAFQSVDTKWDVSTSKAKVAPEK
KQDVGKFVELPGAEMGKVTVRFPPEASGYLHIGHAKAALLNQHYQVNFKGKLIMRFDDTN
PEKEKEDFEKVILEDVAMLHIKPNQFTYTSDHFETIMKYAEKLIQEGKAYVDDTPAEQMK
AEREQRIESKHRNNSIEKNLQMWEEMKKGTQFGQSCCLRAKIDMSSNNGCLRDPTLYRCK
IQPHPRTGSKYNVYPTYDFACPIVDSIEGVTHALRTTEYHDRDEQFYWIIEALGIRKPYI
WEYSRLNLNNTVLSKRKLTWFVDEGLVDGWDDPRFPTVRGVLRRGMTVEGLKQFIAAQGS
SRSVVNMEWDKIWAFNKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPDVG
LKPVWYGPKVFIEGADAETFSEGEMVTFINWGNINITKIYKNEDGKVVSLDAKLNLENKD
YKKTTKITWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXAKVNEAVECLLLLKAEYKEKTGKEYIPGQSPSSQSSDSGSVKNTGTAGPETSE
AKAFFDKVACQGEIVRKLKAEKASKDQVDAAVQELLQLKAQYKSLTGVEYKPVSATGAED
KEKKKKEKENTSEKQSKPQKQNDGQRKDPPKNQGSGLSSSGAGEGQGPKKQTRLGLEAKK
EENLADWYSQVITKSEMIEYYDVSGCYILRPWSYSIWEFIKDFFDTEIKKLGVENCYFPI
FVSQAALEKEKNHVADFAPEVAWVTRSGKTELAEPIAIRPTSETVMYPAYAKWVQSHRDL
PIRLNQWCNVVRWEFKHPQPFLRTREFLWQEGHSAFATFEEAAEEXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGATSHHLGQNFSKMCEIIFEDPK
SPGEKQFAYQCSWGLTTRTIGVMIMVHGDNMGLVLPPRVACVQVVISICWILGGITNTLS
EEDKEALMTKCNDYRQRLLNVNIRVRVDLRDNYSPGWKFNHWELKGVPIRLEVGPRDMKS
CQFVAVRRDTGEKLTIAENEAETKLQAILEDIQVNLFRRASEDLKTHMVVANTLEDFQKI
LDSGKXXXXXXXXXXXXXXXXXXXXXXDQDLELGAPSMGAKSRCIPFKPLRELQPGAKCV
CGKNPAKFYTLFGRSY
Download sequence
Identical sequences ENSDORP00000004053 ENSDORP00000004053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]