SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004108 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004108
Domain Number 1 Region: 396-574
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.45e-29
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 2 Region: 9-126
Classification Level Classification E-value
Superfamily Cadherin-like 9.57e-19
Family Cadherin 0.0025
Further Details:      
 
Domain Number 3 Region: 121-211
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000514
Family Cadherin 0.0046
Further Details:      
 
Domain Number 4 Region: 670-707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000108
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 5 Region: 632-675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family EGF-type module 0.018
Further Details:      
 
Domain Number 6 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000043
Family EGF-type module 0.008
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000004108
Domain Number - Region: 366-405
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0343
Family Laminin-type module 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004108   Gene: ENSDORG00000004394   Transcript: ENSDORT00000004395
Sequence length 1153
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_1436:11587:65460:-1 gene:ENSDORG00000004394 transcript:ENSDORT00000004395 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTATVNIDISDVNDNSPLFTPANYTAVIENKPVGTSILQLVVTDRDSFHNGPPFSFSI
LSGNEEEEFVLDAHGVLRSAVVFQHTESPEYVLCVQAKDSGKPQQVSHSYVRVRVIEEST
HKPTAIPLEIFIVTMEDDFPGGVIGKIHATDQDVYDVLTFALKSEQKSLFKVNSHDGKII
ALGGLDSGKYVLNVSVSDGRFQVPIDVIVHVEQLGHEMLQNTVTIRFENVSPEDFVGLHM
HGFRRTLRNAVLTQKQDNLHIISIQPVAGTNQLDMLFAVEMHNGEFYKPAYLIQKLSNAR
RHLENVMRISAILEKNCSGLDCQEQHCEQGLSLDSHALMTYSTARISFVCPRFYRNVRCT
CNGGVCSGSNDPCVEKPCPGDMQCVGYEASRRPFLCQCPPGKLGECSGHTSLSFGDSYIK
YRLSEDSKEEDFKLALRLTLQSNGIIMYIQANPCIILKIVDGRLWFQLDCGSGPGILGIS
GRAVNDGSWHSVFLELNRNATSLSLDDSYVERRRAPLYFQTLSADSAIYFGALVQPDHVR
GLVDARGAQVLGGFQGCLDSVVLNSHELPLQNKRSSFAEVVGLTELKLGCVLYPEACQRG
PCQHGGSCTSLPSGGYQCTCLSQFTGRNCESEITACFPNPCRNGGSCDPIGNTFICSCKA
GLTGVMCEEDVDECEREECENGGSCVNVFGSFVCNCTPGFVGQSCGLRPVVVPNIQAGHA
YVGKEELIGIAVVLFVIFVLVVLFVVFRKKVFRKNYSRNNITLVQDPATAALLHKSNGGP
FRALRAGDARNLYQEVGPPVPVRPMAYTPCFQSDSRGTLDKAADGLGPEHEMTFHPEPRI
LARRGVVCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGVDDSGDVSCFAGSNKGSNSE
VQSLSSFQSDSGDDNASIVTVIQLVNNVVDTIENEVSVMDQGQNYNRAYHWDTSDWMPGA
RLSDIEEVPNYENQDGGSAHQGSTRELESDYYLGGYDIDSEYPPPHEEEFLSQDQLPPPL
PEDFPDQYEVLAPSQPVSLASTLSPDCRRRPQFHPSQYLPPHPFPNETDLVGTSAGCDFS
TLAVSMNQGTEAPGPKDISLSLHNSRGTSSSDVSANCGFGDSEVAMSDYESVGELSLASL
HVPFVETQHQTQV
Download sequence
Identical sequences ENSDORP00000004108 ENSDORP00000004108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]