SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004770 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004770
Domain Number 1 Region: 279-527
Classification Level Classification E-value
Superfamily SIS domain 5.68e-21
Family mono-SIS domain 0.0045
Further Details:      
 
Domain Number 2 Region: 28-278
Classification Level Classification E-value
Superfamily SIS domain 0.0000000054
Family mono-SIS domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004770   Gene: ENSDORG00000005095   Transcript: ENSDORT00000005096
Sequence length 624
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1944:64619:93530:1 gene:ENSDORG00000005095 transcript:ENSDORT00000005096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTKRXXXXXXXXXXXXXXSGYEAAVPITEKSNPLTRDLDKADAKKIVELLGQCDAEIF
QEEGQAIPAYQRLYSESVLTTMMQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVSF
NQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSALHGIEELKKVAAGKKKVIVIGISAG
LSAPFVAGQMDYCMDNTAVFLPVLVGFNPVSMARNDPIEDWNSTFRQVAERMKKMQEKQE
AFVLNPAVGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGIATSQRYLLEILRTFER
AHQVTYSQSSKIATLMKQVSTSLEKKGRVHLVGWQTLGIIAIMDGVECIHTFGADFRDIR
GFLIGDHSDMFNQKAELTNQGPQFSFSQEDFLTSILPSLKEIDTVIFIFTLDDNLPEVQT
LVEQVKEKTANIQALVHSTVGQSLPLPLKKLFPSIIHIMWPLLFFEYEGTFVQKFQRELS
TKWVLNTVSTGAHVLLGKSLHNYMLDLRIANSKLFWRALAMLQRFSGQSKARCFESLLQA
IHFPQLLSDEIRAAPISRHVHIAHEKEKVIPLALLSLLFRCSIPEALSHLAAAPSVCEVI
RSALAGPGQKRSADTLETLQPAVQ
Download sequence
Identical sequences ENSDORP00000004770 ENSDORP00000004770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]