SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004820 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004820
Domain Number 1 Region: 120-259
Classification Level Classification E-value
Superfamily SH2 domain 1.52e-36
Family SH2 domain 0.00000264
Further Details:      
 
Domain Number 2 Region: 395-495
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.63e-28
Family Protein kinases, catalytic subunit 0.00000174
Further Details:      
 
Domain Number 3 Region: 59-90
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000401
Family SH3-domain 0.00076
Further Details:      
 
Domain Number 4 Region: 242-295
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000006
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004820   Gene: ENSDORG00000005152   Transcript: ENSDORT00000005152
Sequence length 504
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1183:6106:22459:1 gene:ENSDORG00000005152 transcript:ENSDORT00000005152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCKKSKFLREGGKAWKTEPHTNPHNPVYVPDPTSPSKMGPNTNNGNPPGFADAGSEDII
VVALYDYEAIHREDLSFQKGDQLVVLEESEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XWFFKKVSRKDAERHLLTPGNMLGSFMIRDSETTKGSYSLSVRDFDPQQGDTVKHYKIRT
LDSGGFYISPRSTFSTLQELVDHYKKGKDGLCQKLSVPCKTPKPQKPWEKDAWEIPRESL
KLEKRLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLAEANLMKTLQHDKLXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKFPIKWTAPEAINFGSFTIKSDVWS
FGILLMEIVTFGRIPYPGMSNPEVIRSLEHGYRMPRPEHCPVELYNIMTRCWKNRPEERP
TFEYIQSVLDDFYTATESQYQQQP
Download sequence
Identical sequences ENSDORP00000004820 ENSDORP00000004820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]