SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005026 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005026
Domain Number 1 Region: 90-186
Classification Level Classification E-value
Superfamily Snake toxin-like 3.57e-36
Family Extracellular domain of cell surface receptors 0.0000447
Further Details:      
 
Domain Number 2 Region: 190-272
Classification Level Classification E-value
Superfamily Snake toxin-like 2.06e-19
Family Extracellular domain of cell surface receptors 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005026
Domain Number - Region: 4-36
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000687
Family Extracellular domain of cell surface receptors 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005026   Gene: ENSDORG00000005373   Transcript: ENSDORT00000005373
Sequence length 312
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_109:1439:16137:-1 gene:ENSDORG00000005373 transcript:ENSDORT00000005373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRALRCVRCNSTERCRVEECAPGLDLCRITILRTWEXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXRTRSFPVGRYLECMSCSSSDESCERGREQSLQCRH
PREQCVDVVTYQVPEIWEDEQHIKGCGQLPGCPGPTGFHSNHTFHFLQCCNSTKCNQGPA
MQLQQLPPNAVQCYSCEGNSTHGCSEEEATLIPCLGPMDRCLEATGTKEMENTNYTVRGC
ATASWCEGSHMADTFSLTGVSVSCCTGSGCNHPAGDAQYRSGGGPQPRPTYLSLTMTLLT
TARLGGDLLLWT
Download sequence
Identical sequences ENSDORP00000005026 ENSDORP00000005026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]