SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005082 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005082
Domain Number 1 Region: 192-502
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.78e-100
Family Transglutaminase core 0.000000000185
Further Details:      
 
Domain Number 2 Region: 517-628
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.01e-31
Family Transglutaminase, two C-terminal domains 0.00000351
Further Details:      
 
Domain Number 3 Region: 108-191
Classification Level Classification E-value
Superfamily E set domains 2.24e-24
Family Transglutaminase N-terminal domain 0.00000865
Further Details:      
 
Domain Number 4 Region: 630-727
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.89e-23
Family Transglutaminase, two C-terminal domains 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005082   Gene: ENSDORG00000005435   Transcript: ENSDORT00000005435
Sequence length 732
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2413:18281:178569:-1 gene:ENSDORG00000005435 transcript:ENSDORT00000005435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTTSTTFGGRRAVPLNNSNAAEANLPTEELVGLVPRGVNLQXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRYPQENKGTYIPV
PIVSEFQSGKWGAKVIMNEDRSVRLSIQSSPECIVGKFRMYVAVWTPYGILRTPRNQETD
TYILFNPWCEEDAVYLDDEKERQEYVLNDIGVIFYGDFNNVKSRSWSYGQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVNAKDDEGVLVGSWDNIYAYGVPPSAWTGSVDIL
LEYRSSEKPVRYGQCWVFAGVFNTFLRCLGIPARVITNYFSAHDNDANLQMDIFLEEDGR
VSSKLTKDSVWNYHCWNEAWMTRPDLPVGFGGWQAVDSTPQENSDGMYRCGPASVQAVKH
GHVCFQFDAPFVFAEVNSDVIYIRAKKDGTHVVESVDTTHIGKLIVTKKVGEDEIEDITD
TYKFQEGKEEERLALETALMYGAKKALNTEGLVKPRSDVDMNFEVENAVLGKDFKVTITF
QNNSSHRYTISAYLSGNITFYTGVSKMEFKNEAFDITLEPTSFKKEEVLVRASEYMSQLL
EQAFLHFFVTARVNESMDILAKQKSVVLTIPKVIIKVRGAAMVGSDMVVTVEFTNPLDES
LQNVWMHLEGPGVIRPKRKMFRXXXXXXXXXXXXXCRPWVSGHRKLIASMTSDSLRHVYG
ELDLEIQRRPSI
Download sequence
Identical sequences ENSDORP00000005082 ENSDORP00000005082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]