SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005321 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005321
Domain Number 1 Region: 91-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-26
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 2 Region: 133-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.9e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 3 Region: 53-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.32e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005321   Gene: ENSDORG00000005689   Transcript: ENSDORT00000005687
Sequence length 221
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1533:30763:31494:1 gene:ENSDORG00000005689 transcript:ENSDORT00000005687 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGKPKGAISRSSGQGKAPEKKRKAGRQRQHWGVSIRFDTGLSRLPRGLDEKPYKCSKC
EKSFSQSSTLFQHQKIHTGKKSYRCADCGKSFFQSSNLIQHRRVHTGEKPYTCDECGESF
KQSSNLIQHQRTHTGEKPYQCDACGRCFSQSSHLIQHQRTHTGEKPYQCGACHRRFSQSS
HLRQHSKVHAAEPPRKAQGRKVREEGRWPGRKAGTGKKAGA
Download sequence
Identical sequences ENSDORP00000005321 ENSDORP00000005321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]