SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005497 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005497
Domain Number 1 Region: 255-351
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 1.18e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 4524-4587
Classification Level Classification E-value
Superfamily UBC-like 2.62e-21
Family UBC-related 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005497
Domain Number - Region: 3123-3212
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0766
Family CBM15 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005497   Gene: ENSDORG00000005867   Transcript: ENSDORT00000005872
Sequence length 4708
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1988:1083:139855:1 gene:ENSDORG00000005867 transcript:ENSDORT00000005872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAAAASGPGCSSAAAAAAGASGVSEWLVLRDGCMRCDAEGLHSLSYHPALNAILAVT
SRGTIKVIDGTSGATLQASALSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXAQQLLSACLEKVDISSTEGYDLFITQLKDGLKNTSHE
TAANHKVAKWATVTFHLPHHVLKSIASAIVNELKKINQNVAALPVASSVMDRLSYLLPSA
RPELGVGPGRSVDRSLMYSEANRRETFTSWPHVGYRWAQPDPMAQAGFYHQPASSGDDRA
MCFTCSVCLVCWEPTDEPWSEHERHSPNCPFVKGEHTQNVPLAVTLATSPAQFPCTDGXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVHLKFEINAYDPAIVQQLILSGEPSSG
VDSRRPTLAWLEDSSSCSDIPKLEGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGELHFXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXVDLLVDQPFTLEILTSLVELTRFETLTPRFSATVPPCW
VEVQQEQQQRRHPQHLHQQHHGDAAQHTTTWKLQTDSNSWDEHVFELVLPKACMVGHVDF
KFVLNSNITNIPQIQVTLLKNKAPGLGKVNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKSSNVKNENAGGTRK
SENLRGCDLLQEVSVTIRRFKKTSISKERVQRCAMLQFSEFHEKLLNTLCKKADDGQTTE
HAQSLVLDTLCWLAGVHSNGPGSSKEGNESLLSKTRKCLSDIVRVCFFEAGRSIAHKCAR
FLAFCIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSVYWYFVLLNYVKDEDLAGC
STSCASLLTAVSRQLQDRLTPMEALLQTRYGLYSSPFDPVLFDLEMSGSSCKNIYNSNIG
VQSDEIDLSDVLSGNGKVSSCTAAEGSFTSLTGLLEVEPLHFTCVSTSDGTRIERDDAMS
SFGVTPAVGGLSSGTVGEASTALSAAQVALQSLSHAMASAEQQLQVLQEKQQQLLKLXXX
XXKLEAKLHQTTAAAAAAASAASAVGPVHNSVPSNPVAAPGFFIHPSDVIPPTPKTTPLF
MTPPLTPPNEAVSVVINAELAQLFPGSVIDPPAVNLAAHNKNSNKCRMNPLGSGLALAIS
HASHFLQPPPHQSIIIERMHSGARRFVTLDFGRPILLTDVLIPTCGDLASLSIDIWTLGE
EVDGRRLVVATDISTHSLILHDLIPPPVCRFMKITVIGRYGSTNARAKIPLGFYYGHTYI
LPWESELKLMHDPLRGEGEAANQPEIDQHLAMMVALQEDIQCRYNLACHRLEALLQSIDL
PPLNSANNAQYFLRKPDKAVEEDSRVFSAYQDCIQLQLQLNLAHNAVQRLKVAVGASRKT
LSETSNPEDLIQTSSTEQLRTIIRYLLDTLLSLLLSSNGHSVPAVLQSTFHAQACEELFK
HLCISGTPKIRLHTGLLLVQLCGGERWWGQFLSNVLELYNSEQLLIFSQDRVFMLLSCIG
QRSLSNCGVLESLLNLLDNLLSPLQPELPMHRRTEGVLDIPMISWVVMLVSRLLDYVATV
EDEATATKKPLNGNQWSFINNNLHTQSLSRSSKGSSSLDRLYSRKIRKQLVHHKQQLNLL
KAKQKALVEQMEKEKIQSNKGSSYKLLVEQAKLKQATSKHFKDLIRLRRTAEWSRSNIDT
EVTTTKESPEIEPLPFTLAHERCISVVQKLVLFLLSMDFTCHADLLLFVCKELLAPVAAE
AMEEGPVGDDVGATAGDSDDSLQQSSVQLLETIDEPLTHDITGTPPLSSLEKDKEIDLEL
LQDLMEVDIDPLDIDLEKDPLAAKVFKPISSTWYDYWGAEFGTYNYNPYIGGLGIPVAKP
PANTEKNGSQTVSVSVSQALDARLEVGLEQQAELTLKMMSTLEADSILQALTSTSPTLSQ
SPSGTDDSLLGGLQAANPTNQLIIQSSSVPMLNVCFNKLFSMLQVHHVQLESLLQLWLTL
SLNSSSSGNKENGADIFLYNANRIPVISLNQASISSFLTVLAWYPNTLLRTWCLVLHSLT
LMTNMQLNXXXXXVIGTQESTAHLLVSISNLIHVLVKFLSGTSPHGTNQHSPQVGPTATQ
AMQEFLTRLQVHLSSTCPQIFSEFLLKLIHILSTERGAFQTGQGPLDAQVKLLEFTLEQN
FEVVSVSTISAVIESVTFLVHHYITCSDKVMSRSGSDSSVGARACFGGLFANLIRPGDAK
AVCGEMTRDQLMFDLLKLVNILVQLPLSGNREYSARVSVTTNTTDSVSDEEKVSGGKDVN
GSSTTIPGSPAYVADLVLANQQIMSQILSALGLCNSSAMAMIIGASGLHLTKHENFHGGL
NAISVGDGLFTILTTLSKKASTVHMMLQPILTYMACGYMGRQGSLATCQLSEPLLWFILR
VLDTSDALKAFHDMGGVQLICNNMVTSTRAIVNTARSMVSTIMKFLDCGPNKAVDSTLKT
RILASEPDNAEGIHNFAPLGTITSSSPTAQPAEVLLQATPPHRRARSAAWSYIFLPEEAW
CDLTIHLPSAVLLKEIHIQPHLASLATCPSSVSIEVSADGVNMLPLSTPVVTSGLTYIKI
QLVKAEVASAVCLRLHRPRDASTLGLSQIKLLGLTAFGTTSSATVNNPFLPSEDQVSKTS
IGWLRLLHHCLTHISDLEGMMASAAAPTANLLQTCAALLMSPYCGMHSPNIEVVLVKIGL
QSTRIGLKLIDILLRNCAASGSDPTXXXXXXXXXXXXXXXXXXXXDILYQLGTTQDPGTK
DRIQALLKWVSDSARVAALKRSGRLNYVSPSSSSIEYGLLMPSPSHLHCVAAILWHSYEL
LVEYDLPALLDRELFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXESIAQSIDVSQDKLRRHHVPQHCNKMPITADLVARIL
RFLTEVGNSHIMDWLGGSEVNPLWTALLFLLCHSGSTSGGHNLGVQQTTSARSASLSSAT
ATGLTTQQRTAIENATVAFFLQCISCHPNNQKLMAQXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKSQSKRA
VSATPCRPPSRRGRAIPDKIGSTSSGAETANKIITVPEFHLFHKLLSGQPLPAEMTLAQL
LTLLYDRKLPQGYRSIDLIVKLGSRVITDPSLSKTDSFKRLHPEKDHGDLLGNCPEDEAL
TPSDECMDGILDESLLETCPIQSPLQVFAGMGGLALIAERLPMLYPEVIQQVSAPVVTST
TQEKPKDSDQFEWVTIEQSGELVYEAPETIAAEPPPIKSAVQTMSPIPAHSLAAFGLFLR
LPGYAEVLLKERKHAQCLLRLVLGVTDDGEGXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQVSSSHNPTSTEEQQ
LYWAKGTGFGTGSTASGWDVEQALTKQRLEEEHVTCLLQXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDMARHVPLYRALLELLRAIASCT
SMVPLLLPLSTENGEEEEEQTECQTSVGTLLAKMKTCVDTYTNRLXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXFLITGPADTPYANGCFEFDVYFPQDYPSSPPLVNLE
TTGGHSVRFNPNLYNDGKVCLSILNTWHGRPEEKWNPQTSSFLQXXXXXXXXXXXXXXXX
XXXXXXXXXXXPSGTQSSREYDGIRQAVKWAMLEQIRPSCFKEVIHKHFYLKRIEIMAQC
EEWIADIQQYSSDKRVGRTMSHHAAALK
Download sequence
Identical sequences ENSDORP00000005497 ENSDORP00000005497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]