SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000005606 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000005606
Domain Number 1 Region: 1229-1305,1345-1568
Classification Level Classification E-value
Superfamily NHL repeat 3.66e-23
Family NHL repeat 0.003
Further Details:      
 
Domain Number 2 Region: 924-995
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000471
Family Pre-dockerin domain 0.086
Further Details:      
 
Domain Number 3 Region: 633-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000827
Family EGF-type module 0.044
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000005606
Domain Number - Region: 1537-1721
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000281
Family All0351-like 0.052
Further Details:      
 
Domain Number - Region: 666-692
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000555
Family EGF-type module 0.075
Further Details:      
 
Domain Number - Region: 763-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000639
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 733-757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00105
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 599-626
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00639
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 801-834
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000005606   Gene: ENSDORG00000005982   Transcript: ENSDORT00000005984
Sequence length 2766
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3881:3794:312387:-1 gene:ENSDORG00000005982 transcript:ENSDORT00000005984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVKDRKPYRSLTRRRDAERRYTSSSADSEEGKAPQKSYSSSETLKAYDQDARLAYGGRV
KDMVPQEAEEFCRGGTNFTLRELGLGEVTPPHGTLYRTDIGLPHCGYSMGASSDADLEAD
TVLSPEHPVRLWGRSTRSGRSSCLSSRANSNLTLTDTEHENTETDHPGGLQNHPRLRTPP
PPLSHAHTPNQHHAASINSLNRGNFTPRSNPSPAPTDHSLSGEPPAGSAQEPAHAQDNWL
LNSNIPLETRNLGKQPFLGTLQDNLIEMDILSASRHDGAYSDGHFLFKPGGTSPLFCTTS
PGYPLTSSTVYSPPPRPLPRSTFSRPALNLKKPSKYCNWKCAALSAIVISATLVILLAYF
VAMHLFGLNWHLQPMEGQMYEITEDTASSWPVPTDVSLYPSGGTGLETPDRKGKGAAEGK
PSSFFPEDSFIDSGEIDVGRRASQKIPPGTFWRSQVFIDHPVHLKFNVSLGKAALVGIYG
RKGLPPSHTQFDFVELLDGRRLLTQEARSLEGPQRQSRGVVPPSSHETGFIQYLDSGIWH
LAFYNDGKESEVVSFLTTAVESVDNCPSNCYGNGDCISGTCHCFLGFLGPDCGRASCPVL
CSGNGQYMKGRCLCHSGWKGAECDVPTSQCIDVACSSHGTCIMGTCICNPGYKGESCEEV
DCMDPTCSGRGVCVRGECHCSVGWGGTNCETPRATCLDQCSGHGTFLPDTGLCNCDPSWT
GHDCSIEICSADCGGHGVCVGGTCRCQDGWTGTACDQRACHPRCAEHGTCRDGRCECSPG
WNGEHCTIXXXXXXXXXXGCPGLCNGNGRCTLGLNGWQCVCQLGWRGAGCDTSMETACGD
SKDNDGDGLVDCMDPDCCLQPLCHSNSLCLGSPDPLDIIQHMQTPVFQQNLQSFYDRIKF
LVGRDSTHIIPGENPFDGGHACVIRGQVMTSDGTPLIGVNISFVNNPLFGYTISRQDGSF
DLVTNGGISIILRFERTPFITQEHTLWLPWDRFFVMETIIMRHEENEIPSCDLSNFARPN
PVLSPSPLTSFASSCAEKGPIVPEIQALQEEIIISGCKMRLSYLSSRTAGYKSVLRISLT
HPTIPFNLMKVHLMVAVEGRLFRKWFAAAPDLSFHFIWDKTDVYNQKVYGLSEAFVSVGY
EYESCPDLILWEKRTAVLQGYEIDASKLGGWTLDKHHALNIQSGILHKGNGENQFVSQQP
PVIGSIMGNGRRRSISCPSCNGLADGNKLLAPMALTCGSDGSLYVGDFNYIRRIFPSGNV
TNILELRNKFRHSHSPAHKYYLTTDPMSGAVFLSDTNSRRVFRIKSTMVVKDVVKNSEVV
AGTGDQCLPFDDTRCGDGGKATEATLTNPRGITVDKFGLIYFVDGTMIRRVDQNGIISTL
LGSNDLTSARPLSCDSVMDISQVRLEWPTDLAINPMDNSLYVLDNNVVLQISENHQVRIV
AGRPMHCQVPGIDHFLLSKVAIHATLESATALAVSHNGVLYIAETDEKKINRIRQVTTSG
EISLVAGAPSGCDCKNDANCDCFSGDDGYAKDAKLNTPSSLAVCADGELYVADLGNIRIR
FIRKNKPFNTQNMYELSSPIDQELYLFDTSGRHLYTQSLPTGDYLYNFTYTEDGDITRIT
DNNGNMVDVRRDSSGMPLWLVVPNGQVYWVTIGINSALRSLTTQGHELAMMTYHGSSGLL
ATKSNENGWTTFYEYDSFGRLTNVTFPTGQVSSFRSDTDSSVHVQVETSSKDDVTITTNL
SASGAFYTLLQDQVRNSYYIGADGSLRLLLANGMEVALQTEPHLLAGTVNPTVGKRNVTL
PIDNGLNLVEWRQRKEQARGQVTVFGRRLRVHNRNLLSLDFDRVTRTEKIYDDHRKFTLR
ILYDQAGRPSLWSSSRLNGVNVTYSRKGRIAGIQRGIMSERMEYDQEGRISSRIFADGKT
WTYTYLEKSMMLLLHSQKQYMFEFDENGRLASVTMPNVARQTLETIRSVGYYRNIYQPPE
GNASVIQDFTEDGHLLHTFYLGTGRRVIYKYGKLSKLAETLYDTTKVSFTYDETAGMLKT
INLQNEGFTCTIRYRQIGPLIDRQIFRFTEEGMVNARFDYNYDNSFRVTSMQAVINETPL
PIDLYRYDDVSGKTEQFGKFGVIYYDINQIITTAVMTHTKHFDAYGRMKEVQYEIFRSLM
YWMTVQYDNMGRVVKKELKVGPYANTTRYSYEYDVDGQLQAVSINDRPLWRYSYDLNGNL
HLLSPGNSARLTPIRYDLRDRITRLGDVQYKMDEDGFLQQRGGDVFEYNSAGLLIKAYNR
ASGWSVRYRYDGLGRRVSSKSSHSHHLQFFYADLTNPTKVTHLYNHSSSEITSLYYDLQG
HLFAMELSSGDEFYIACDNVGTPLAVFSGTGLMIKQILYTAFGEIYMDTNPNFQIIIGYH
GGLYDPFTKLVHMGRRDYDVLAGRWTSPNHELWKHLSSSNLMPFNLYMFKNNNPISNSQD
IKCFMTDVNSWLLTFGFQLHNVIPGYPKPDTDAMEPSYELVHTQMKTQEWDNSKSILGVQ
CEVQKQLKAFVTLERFDQLYGSTITSCQQAPETKKFAFKGSIFGKGVKFALKDGRVTTDI
ISVANEDGRRIATILNNAHYLENLHFTIDGMDTHYFVKPGSSESDLAILGLSGGQRTLEN
GVNVTVSQINTMLNGRTRRYTDIQLQYRALCLNTRYGTTLDEEKARVLELARQRAVSQAW
AREQQRLREGEEGLRAWTEGEKQQVLNTGRVQGYDGFFVISVEQYPELSDSVNNIHFMRQ
SEMGRR
Download sequence
Identical sequences ENSDORP00000005606 ENSDORP00000005606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]